Potri.016G123501 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G01540 182 / 2e-54 LECRKA4.1 lectin receptor kinase a4.1 (.1)
AT3G08870 177 / 2e-52 Concanavalin A-like lectin protein kinase family protein (.1)
AT5G01550 177 / 2e-52 LECRKA4.2 lectin receptor kinase a4.1 (.1)
AT5G01560 171 / 3e-50 LECRKA4.3 lectin receptor kinase a4.3 (.1)
AT2G37710 166 / 1e-48 RLK receptor lectin kinase (.1)
AT4G02420 162 / 3e-47 Concanavalin A-like lectin protein kinase family protein (.1)
AT3G53810 159 / 5e-46 Concanavalin A-like lectin protein kinase family protein (.1)
AT4G02410 158 / 2e-45 Concanavalin A-like lectin protein kinase family protein (.1)
AT3G55550 156 / 7e-45 Concanavalin A-like lectin protein kinase family protein (.1)
AT1G70130 149 / 2e-42 Concanavalin A-like lectin protein kinase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G123300 348 / 4e-118 AT5G01550 629 / 0.0 lectin receptor kinase a4.1 (.1)
Potri.016G122650 344 / 2e-116 AT5G01550 576 / 0.0 lectin receptor kinase a4.1 (.1)
Potri.006G103200 288 / 1e-94 AT3G08870 644 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1)
Potri.001G244000 174 / 1e-51 AT3G53810 570 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1)
Potri.006G088900 172 / 1e-50 AT2G37710 801 / 0.0 receptor lectin kinase (.1)
Potri.006G088600 170 / 5e-50 AT2G37710 808 / 0.0 receptor lectin kinase (.1)
Potri.009G035701 168 / 9e-50 AT3G53810 585 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1)
Potri.006G088680 169 / 1e-49 AT2G37710 787 / 0.0 receptor lectin kinase (.1)
Potri.009G035400 167 / 8e-49 AT3G53810 629 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022662 188 / 2e-56 AT5G01550 651 / 0.0 lectin receptor kinase a4.1 (.1)
Lus10012509 179 / 2e-53 AT3G08870 555 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1)
Lus10040774 176 / 4e-52 AT3G53810 713 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1)
Lus10016507 173 / 6e-51 AT3G53810 705 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1)
Lus10040773 171 / 2e-50 AT3G53810 654 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1)
Lus10004982 171 / 4e-50 AT3G53810 664 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1)
Lus10016506 169 / 2e-49 AT3G53810 651 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1)
Lus10001562 168 / 3e-49 AT3G53810 655 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1)
Lus10035627 167 / 6e-49 AT2G37710 755 / 0.0 receptor lectin kinase (.1)
Lus10001564 167 / 8e-49 AT3G53810 639 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF00069 Pkinase Protein kinase domain
Representative CDS sequence
>Potri.016G123501.1 pacid=42809833 polypeptide=Potri.016G123501.1.p locus=Potri.016G123501 ID=Potri.016G123501.1.v4.1 annot-version=v4.1
ATGAACGGGCGGTTAGGAGACTTTGGTCTAGCCAGGCTGTATGATCATGGAACCATGTCGCACACCACAAATATTGTTGGCACGATAGGGTATATCGCAC
CTGAATTGGCACGGACCGGTCAGGCTTCTACCAGTTCCGATGTGTACGCGTACGGTATTTTGCTCCTTGAAGTGGCTTGTGGCAGAAAGCCCGTTGAAAC
GAGTAACTTCATCCTGACAGATTTCGTGATTGAATGCCATCAAAAGGGTAGAGTTCTTGATGCAGCTGATCCAGAGCTGAACTCTGCCTTCGTGGTCAAG
GAAATGGACGTGGTGCTGGGGTTGGGTCTTCTGTGTTCTCATCACAAGCCTAAAGCCAGGCCAACCATGAGAGAAGTCATACGGTATCTCAACTGGGAAG
ACAAGCTCCCAGTGATTGATGATCTAGGTTCTTCTGATTCTCCATGTAGGAGCTCAAGATATATGGGAGAGGTTTCCATTGAAATGATCACAAGTTCCAT
AGATTGTGGCAGATAG
AA sequence
>Potri.016G123501.1 pacid=42809833 polypeptide=Potri.016G123501.1.p locus=Potri.016G123501 ID=Potri.016G123501.1.v4.1 annot-version=v4.1
MNGRLGDFGLARLYDHGTMSHTTNIVGTIGYIAPELARTGQASTSSDVYAYGILLLEVACGRKPVETSNFILTDFVIECHQKGRVLDAADPELNSAFVVK
EMDVVLGLGLLCSHHKPKARPTMREVIRYLNWEDKLPVIDDLGSSDSPCRSSRYMGEVSIEMITSSIDCGR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G01540 LECRKA4.1 lectin receptor kinase a4.1 (.... Potri.016G123501 0 1
AT5G38260 Protein kinase superfamily pro... Potri.007G125600 1.00 0.9696
AT2G29100 ATGLR2.9 GLUTAMATE RECEPTOR 2.9, gluta... Potri.004G052600 2.44 0.9619
AT5G38260 Protein kinase superfamily pro... Potri.007G125450 3.46 0.9674
AT2G17270 PHT3;3 phosphate transporter 3;3 (.1) Potri.004G207200 4.47 0.9473
AT4G14450 ATBET12 unknown protein Potri.010G073900 4.89 0.9268 Pt-ATBET12.2
AT5G54585 unknown protein Potri.011G130400 5.09 0.9194
AT5G36930 Disease resistance protein (TI... Potri.013G098100 6.32 0.9364
AT5G64230 unknown protein Potri.017G053200 8.30 0.9204
AT3G25950 TRAM, LAG1 and CLN8 (TLC) lipi... Potri.008G178800 8.48 0.9297
AT1G14780 MAC/Perforin domain-containing... Potri.008G136401 9.94 0.9288

Potri.016G123501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.