Plant FIBer expression Database

Potri.016G124100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G58420 456 / 1e-164 Ribosomal protein S4 (RPS4A) family protein (.1)
AT2G17360 456 / 2e-164 Ribosomal protein S4 (RPS4A) family protein (.1), Ribosomal protein S4 (RPS4A) family protein (.2)
AT5G07090 456 / 2e-164 Ribosomal protein S4 (RPS4A) family protein (.1), Ribosomal protein S4 (RPS4A) family protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G103700
[exp]
475 / 3e-172 AT5G58420 465 / 3e-168 Ribosomal protein S4 (RPS4A) family protein (.1)
Potri.015G033700
[exp]
474 / 7e-172 AT5G07090 468 / 3e-169 Ribosomal protein S4 (RPS4A) family protein (.1), Ribosomal protein S4 (RPS4A) family protein (.2)
Potri.015G079600
[exp]
471 / 3e-170 AT5G07090 460 / 4e-166 Ribosomal protein S4 (RPS4A) family protein (.1), Ribosomal protein S4 (RPS4A) family protein (.2)
Potri.013G011000
[exp]
469 / 9e-170 AT2G17360 452 / 6e-163 Ribosomal protein S4 (RPS4A) family protein (.1), Ribosomal protein S4 (RPS4A) family protein (.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004272
[exp]
446 / 2e-160 AT5G58420 499 / 0.0 Ribosomal protein S4 (RPS4A) family protein (.1)
Lus10019239
[exp]
446 / 2e-151 AT2G22660 747 / 0.0 Protein of unknown function (duplicated DUF1399) (.1), Protein of unknown function (duplicated DUF1399) (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF00467 KOW KOW motif
CL0021 OB PF00900 Ribosomal_S4e Ribosomal family S4e
CL0021 PF16121 40S_S4_C 40S ribosomal protein S4 C-terminus
Representative CDS sequence
>Potri.016G124100.1 pacid=42808884 polypeptide=Potri.016G124100.1.p locus=Potri.016G124100 ID=Potri.016G124100.1.v4.1 annot-version=v4.1
ATGGCTAGAGGGTTGAAGAAGCACTTGAAGAGGCTTAATGCTCCAAAACATTGGATGCTTGATAAACTTGGTGGTGCTTTTGCCCCCAAGCCCTCATCCG
GACCCCACAAGTCTAGGGAATGCTTGCCTCTGATTCTCATTCTGCGAAACAGGCTCAAGTATGCTTTGACATACCGTGAAGTGATTTCTATTTTGATGCA
GAGACATGTTCTTGTTGATGGGAAGGTTAGGACAGATAAAACCTACCCATCTGGTTTCATGGATGTTGTGTCAATCCCAAAGACAAACGAGAGCTTCCGT
CTCCTCTATGACACCAAAGGCCGCTTCCGGCTCCACTCCCTCAGAGAGGACGAGGCTAAGTTCAAGCTTTGCAAAGTTCGGTCAATTCAGTTTGGGCAGA
AAGGAATTCCCTATCTGAACACCTATGATGGGCGCACCATCCGCTACCCAGATCCCCTCATTAAGGCCAATGACACCATCAAGCTGGATCTAGAGAGCAA
CAAGATAGTTGACTTCATCAAGTTTGATGTGGGAAATGTTGTCATGGTCACTGGAGGAAGGAATAGAGGCCGAGTTGGAGTAATCAAGAACAGGGAGAAG
CATAAGGGAAGCTTTGAGACAATCCATGTTCAAGATGCCACTGGCCATGAGTTTGCCACTCGCCTGGGCAACGTGTTCACCATTGGAAAGGGCTCCAAGC
CATGGATTTCTCTTCCCAAGGGCAAGGGTATTAAATTGTCCATCATTGAGGAGGCTAAAAAGAGGCTTGCAGCATCTCAGGCTGCTGCATGA
AA sequence
>Potri.016G124100.1 pacid=42808884 polypeptide=Potri.016G124100.1.p locus=Potri.016G124100 ID=Potri.016G124100.1.v4.1 annot-version=v4.1
MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFR
LLYDTKGRFRLHSLREDEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGRVGVIKNREK
HKGSFETIHVQDATGHEFATRLGNVFTIGKGSKPWISLPKGKGIKLSIIEEAKKRLAASQAAA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G58420 Ribosomal protein S4 (RPS4A) f... Potri.016G124100
[exp]
0 1
AT2G27530 PGY1 PIGGYBACK1, Ribosomal protein ... Potri.007G034800
[exp]
2.82 0.9553
AT3G05590 RPL18 ribosomal protein L18 (.1) Potri.013G013600
[exp]
4.47 0.9536 RPL18.11
AT2G47110 UBQ6 ubiquitin 6 (.1.2) Potri.012G114000
[exp]
6.92 0.9458
AT4G13170 Ribosomal protein L13 family p... Potri.002G242600
[exp]
7.93 0.9483 Pt-RPL13.3
AT3G57490 Ribosomal protein S5 family pr... Potri.006G052400
[exp]
8.12 0.9320 Pt-RPS2.2
AT2G37190 Ribosomal protein L11 family p... Potri.006G077200
[exp]
14.96 0.9378 RPL12.4
AT1G74050 Ribosomal protein L6 family pr... Potri.009G065800
[exp]
15.49 0.9450
AT5G04800 Ribosomal S17 family protein (... Potri.010G241200
[exp]
16.73 0.9454
AT4G09800 RPS18C S18 ribosomal protein (.1) Potri.002G051300
[exp]
17.32 0.9338
AT4G16720 Ribosomal protein L23/L15e fam... Potri.002G141500
[exp]
18.33 0.9307 Pt-RPL15.6

Potri.016G124100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.