Potri.016G125000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G41480 420 / 5e-148 Peroxidase superfamily protein (.1)
AT5G64120 417 / 4e-147 Peroxidase superfamily protein (.1)
AT5G39580 410 / 2e-144 Peroxidase superfamily protein (.1.2)
AT5G64110 363 / 1e-125 Peroxidase superfamily protein (.1)
AT5G64100 343 / 5e-118 Peroxidase superfamily protein (.1)
AT4G25980 307 / 3e-103 Peroxidase superfamily protein (.1)
AT1G77100 278 / 2e-92 Peroxidase superfamily protein (.1)
AT1G05260 267 / 5e-88 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
AT5G06720 264 / 1e-86 ATPA2 peroxidase 2 (.1)
AT4G11290 263 / 1e-86 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G069600 412 / 2e-145 AT2G41480 498 / 6e-179 Peroxidase superfamily protein (.1)
Potri.018G131600 390 / 2e-136 AT2G41480 478 / 4e-171 Peroxidase superfamily protein (.1)
Potri.017G038100 275 / 3e-91 AT1G05260 479 / 7e-172 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Potri.007G122301 271 / 9e-90 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122250 271 / 9e-90 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122401 271 / 9e-90 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122351 271 / 9e-90 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.017G037900 270 / 4e-89 AT1G05260 481 / 2e-172 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Potri.007G122200 270 / 5e-89 AT5G15180 395 / 2e-138 Peroxidase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007051 477 / 9e-171 AT2G41480 403 / 1e-141 Peroxidase superfamily protein (.1)
Lus10007052 470 / 4e-168 AT2G41480 400 / 1e-140 Peroxidase superfamily protein (.1)
Lus10012684 454 / 1e-161 AT2G41480 395 / 2e-138 Peroxidase superfamily protein (.1)
Lus10020826 427 / 6e-151 AT2G41480 375 / 1e-130 Peroxidase superfamily protein (.1)
Lus10015555 382 / 4e-133 AT2G41480 432 / 9e-153 Peroxidase superfamily protein (.1)
Lus10020421 317 / 1e-108 AT2G41480 266 / 9e-89 Peroxidase superfamily protein (.1)
Lus10025535 288 / 2e-94 AT5G19890 406 / 9e-141 Peroxidase superfamily protein (.1)
Lus10026748 282 / 1e-93 AT5G19890 402 / 6e-141 Peroxidase superfamily protein (.1)
Lus10015127 277 / 6e-92 AT1G05260 444 / 7e-158 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Lus10031548 277 / 7e-92 AT1G05260 441 / 1e-156 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Potri.016G125000.1 pacid=42809895 polypeptide=Potri.016G125000.1.p locus=Potri.016G125000 ID=Potri.016G125000.1.v4.1 annot-version=v4.1
ATGAGCCAAAAAATAGTTTTAATGTTTCTTTTGCTGGCCATGGTTGGTACCACCATGGTGCAAGGCCAAGGCACTCGTGTTGGGTTTTATGCAACGACGT
GCCGTAGGGCTGAATCCATTGTTCGGGCAACAGTCCAGTCTCATTTCACGTCTGATTCCTCTATTGCACCTGGGCTCCTCAGGATGCATTTCCATGATTG
CTTTGTGAATGGTTGTGATGCTTCCATCCTCATTGATGGCGCTAATACTGAAAAAACTGCTAGGCCAAACCTTCTGTTGAGAGGATATGATGTCATTGCT
GATGCCAAGACTCAGCTTGAAGCTGAGTGCCCTGGTGTTGTCTCATGTGCAGACATTCTAGCCCTTGCTGCTCGTGATTCTGTTGTTTTGACAAAGGGAC
TCACTTGGCCAGTGCCCACAGGACGGAGAGACGGTAGGGTTTCATTGGCATCCGATACATCTAATTTGCCAGGTTTCACCGACTCTGTTGACGTGCAGAA
ACAGAAGTTTGCAGCATTTGGTCTCAACGCTCAAGATCTTGTTACCCTTGTTGGAGGACACACCATAGGAACCACTGCTTGTCAATTCTTCAGTTACAGA
CTGTACAATTTCACTACAACAGGAAATGGCGCGGACCCATCCATCAACCCTTCATTCGTCTCTCAACTACAGACACTCTGTCCACAGAATGGTGATGGGT
CAAGGCGTATTGCTCTAGACACTGGTAGCCAAAATCGTTTTGATTCATCTTTCTTTTCAAATTTGAGAAGTGGTCAAGGAATACTTGAATCTGATCAAAA
GTTATGGACTGATGCAACCACAAGAACTTTTGTCCAGCGCTTCCTTGGTGTCAGAGGCCTGGCTGGGCTTACGTTTGGTGCGGAGTTTGGCAGGTCCATG
GTCAAGATGAGTAACATCGGTGTGAAAACCGGCACTAATGGTGAAATTCGAAGAGTGTGTTCTGCTATAAATTGA
AA sequence
>Potri.016G125000.1 pacid=42809895 polypeptide=Potri.016G125000.1.p locus=Potri.016G125000 ID=Potri.016G125000.1.v4.1 annot-version=v4.1
MSQKIVLMFLLLAMVGTTMVQGQGTRVGFYATTCRRAESIVRATVQSHFTSDSSIAPGLLRMHFHDCFVNGCDASILIDGANTEKTARPNLLLRGYDVIA
DAKTQLEAECPGVVSCADILALAARDSVVLTKGLTWPVPTGRRDGRVSLASDTSNLPGFTDSVDVQKQKFAAFGLNAQDLVTLVGGHTIGTTACQFFSYR
LYNFTTTGNGADPSINPSFVSQLQTLCPQNGDGSRRIALDTGSQNRFDSSFFSNLRSGQGILESDQKLWTDATTRTFVQRFLGVRGLAGLTFGAEFGRSM
VKMSNIGVKTGTNGEIRRVCSAIN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G41480 Peroxidase superfamily protein... Potri.016G125000 0 1
AT3G57630 exostosin family protein (.1.2... Potri.006G054800 1.73 0.8321
AT2G46370 FIN219, JAR1 JASMONATE RESISTANT 1, FAR-RED... Potri.014G095500 2.44 0.8254
AT5G36110 CYP716A1 "cytochrome P450, family 716, ... Potri.001G003100 5.56 0.8791
AT2G39370 MAKR4 MEMBRANE-ASSOCIATED KINASE REG... Potri.006G214700 6.00 0.8479
AT3G48880 RNI-like superfamily protein (... Potri.001G373900 9.16 0.8247
AT1G75750 GASA1 GAST1 protein homolog 1 (.1.2) Potri.002G022700 9.38 0.7136
AT5G36110 CYP716A1 "cytochrome P450, family 716, ... Potri.004G017800 11.83 0.7826
AT1G29670 GDSL-like Lipase/Acylhydrolase... Potri.012G137550 18.43 0.8315
AT3G14460 LRR and NB-ARC domains-contain... Potri.017G121901 21.02 0.7846
Potri.017G018100 22.22 0.7538

Potri.016G125000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.