Potri.016G125700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G19350 81 / 1e-18 BZR BZR2, BES1 BRASSINAZOLE-RESISTANT 2, BRI1-EMS-SUPPRESSOR 1, Brassinosteroid signalling positive regulator (BZR1) family protein
AT3G50750 77 / 2e-17 BZR BEH1 BES1/BZR1 homolog 1 (.1)
AT4G36780 75 / 2e-16 BZR BEH2 BES1/BZR1 homolog 2 (.1)
AT1G75080 75 / 3e-16 BZR BZR1 BRASSINAZOLE-RESISTANT 1, Brassinosteroid signalling positive regulator (BZR1) family protein (.1), Brassinosteroid signalling positive regulator (BZR1) family protein (.2)
AT4G18890 73 / 7e-16 BZR BEH3 BES1/BZR1 homolog 3 (.1)
AT1G78700 70 / 1e-14 BZR BEH4 BES1/BZR1 homolog 4 (.1)
AT5G45300 59 / 8e-11 BZR BAM8, BMY2 BETA-AMYLASE 8, beta-amylase 2 (.1.2)
AT2G45880 56 / 2e-09 BZR BAM7, BMY4 BETA-AMYLASE 4, beta-amylase 7 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G126400 77 / 3e-17 AT1G75080 269 / 1e-88 BRASSINAZOLE-RESISTANT 1, Brassinosteroid signalling positive regulator (BZR1) family protein (.1), Brassinosteroid signalling positive regulator (BZR1) family protein (.2)
Potri.014G041600 76 / 6e-17 AT1G75080 349 / 2e-120 BRASSINAZOLE-RESISTANT 1, Brassinosteroid signalling positive regulator (BZR1) family protein (.1), Brassinosteroid signalling positive regulator (BZR1) family protein (.2)
Potri.002G133700 76 / 7e-17 AT1G75080 326 / 2e-111 BRASSINAZOLE-RESISTANT 1, Brassinosteroid signalling positive regulator (BZR1) family protein (.1), Brassinosteroid signalling positive regulator (BZR1) family protein (.2)
Potri.011G106800 69 / 2e-14 AT1G78700 362 / 1e-125 BES1/BZR1 homolog 4 (.1)
Potri.004G062400 69 / 3e-14 AT1G78700 337 / 1e-115 BES1/BZR1 homolog 4 (.1)
Potri.007G030700 68 / 6e-14 AT1G75080 274 / 7e-91 BRASSINAZOLE-RESISTANT 1, Brassinosteroid signalling positive regulator (BZR1) family protein (.1), Brassinosteroid signalling positive regulator (BZR1) family protein (.2)
Potri.003G026600 68 / 6e-14 AT1G78700 341 / 4e-117 BES1/BZR1 homolog 4 (.1)
Potri.001G386900 68 / 6e-14 AT1G78700 340 / 7e-117 BES1/BZR1 homolog 4 (.1)
Potri.011G071800 67 / 2e-13 AT1G78700 334 / 2e-114 BES1/BZR1 homolog 4 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026036 77 / 2e-17 AT1G75080 303 / 2e-102 BRASSINAZOLE-RESISTANT 1, Brassinosteroid signalling positive regulator (BZR1) family protein (.1), Brassinosteroid signalling positive regulator (BZR1) family protein (.2)
Lus10014327 77 / 5e-17 AT1G75080 309 / 1e-104 BRASSINAZOLE-RESISTANT 1, Brassinosteroid signalling positive regulator (BZR1) family protein (.1), Brassinosteroid signalling positive regulator (BZR1) family protein (.2)
Lus10010795 77 / 5e-17 AT1G75080 332 / 2e-113 BRASSINAZOLE-RESISTANT 1, Brassinosteroid signalling positive regulator (BZR1) family protein (.1), Brassinosteroid signalling positive regulator (BZR1) family protein (.2)
Lus10016307 77 / 6e-17 AT1G75080 392 / 5e-137 BRASSINAZOLE-RESISTANT 1, Brassinosteroid signalling positive regulator (BZR1) family protein (.1), Brassinosteroid signalling positive regulator (BZR1) family protein (.2)
Lus10007319 71 / 1e-14 AT1G78700 310 / 2e-104 BES1/BZR1 homolog 4 (.1)
Lus10005419 70 / 2e-14 AT1G78700 348 / 9e-120 BES1/BZR1 homolog 4 (.1)
Lus10015238 70 / 2e-14 AT1G78700 347 / 3e-119 BES1/BZR1 homolog 4 (.1)
Lus10029270 68 / 7e-14 AT1G78700 311 / 3e-105 BES1/BZR1 homolog 4 (.1)
Lus10035679 63 / 7e-12 AT5G45300 884 / 0.0 BETA-AMYLASE 8, beta-amylase 2 (.1.2)
Lus10018842 56 / 2e-09 AT2G45880 879 / 0.0 BETA-AMYLASE 4, beta-amylase 7 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05687 BES1_N BES1/BZR1 plant transcription factor, N-terminal
Representative CDS sequence
>Potri.016G125700.1 pacid=42809039 polypeptide=Potri.016G125700.1.p locus=Potri.016G125700 ID=Potri.016G125700.1.v4.1 annot-version=v4.1
ATGGTAGATGAAAAGAAGGTGGTGTTAAGTGGCTGCATCAAGACTAGCAGGGGGCCTTGGAGAGTACATAGAGCTACAAAAGATGGCCGCATTGTCACCA
AATTTCGCTATCCTTCTGATAGGGAACGGCAAACGAACCAGCAGAGGGAGCGTCGAAGACGAGCAGTGGCTAAGAAAATTTTTGAAGGTCTTCGAAAGCA
TGGAAACTACAAGCTTCCGAAACATGCAGACAGCAATGACCTGCTCAAGGCTCTCTGTGAGGAAGCAGGATGGCTCGTTGAGGAGGATGGCACCATTTGT
AGGATGGTTCTTCATAACCCTTATCATGAAGCTAATGTTGCAAGCTCCTATGATGCCTCGCCAGAAGATCACAATTACTGCACCTGCAACAATCATTTGG
ATTCAGAATATGGAGCATTTCCACTGAGCACCAGCTCACCAATTCAAGAGTGCCATGGAGGAAATGATGTCAACCTCATCCTTTCACTCTAG
AA sequence
>Potri.016G125700.1 pacid=42809039 polypeptide=Potri.016G125700.1.p locus=Potri.016G125700 ID=Potri.016G125700.1.v4.1 annot-version=v4.1
MVDEKKVVLSGCIKTSRGPWRVHRATKDGRIVTKFRYPSDRERQTNQQRERRRRAVAKKIFEGLRKHGNYKLPKHADSNDLLKALCEEAGWLVEEDGTIC
RMVLHNPYHEANVASSYDASPEDHNYCTCNNHLDSEYGAFPLSTSSPIQECHGGNDVNLILSL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G19350 BZR BZR2, BES1 BRASSINAZOLE-RESISTANT 2, BRI1... Potri.016G125700 0 1
AT1G80260 EMB1427 embryo defective 1427, Spc97 /... Potri.014G184701 2.00 0.8521
AT5G15880 unknown protein Potri.004G105400 2.44 0.8511
AT3G11470 4'-phosphopantetheinyl transfe... Potri.010G238500 2.82 0.8606
AT2G20495 unknown protein Potri.005G225900 4.58 0.7847
AT1G75060 unknown protein Potri.003G130100 6.85 0.7600
AT5G16650 Chaperone DnaJ-domain superfam... Potri.013G078200 7.93 0.8104
AT4G17150 alpha/beta-Hydrolases superfam... Potri.016G001000 8.36 0.8102
Potri.010G031250 8.83 0.8228
AT2G34400 Pentatricopeptide repeat (PPR-... Potri.018G145510 10.48 0.7839
AT2G21940 ATSK1 shikimate kinase 1 (.1.2.3.4.5... Potri.002G061100 12.08 0.7023

Potri.016G125700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.