Potri.016G126400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G38360 209 / 1e-68 PRA1.B4 prenylated RAB acceptor 1.B4 (.1)
AT3G56110 184 / 7e-59 PRA1.B1 prenylated RAB acceptor 1.B1 (.1.2)
AT5G01640 176 / 3e-55 PRA1.B5 prenylated RAB acceptor 1.B5 (.1)
AT2G40380 171 / 3e-53 PRA1.B2 prenylated RAB acceptor 1.B2 (.1)
AT5G05380 165 / 6e-51 PRA1.B3 prenylated RAB acceptor 1.B3 (.1)
AT5G07110 132 / 3e-38 PRA1.B6 prenylated RAB acceptor 1.B6 (.1)
AT1G08770 74 / 3e-16 PRA1.E prenylated RAB acceptor 1.E (.1)
AT3G13720 71 / 3e-15 PRA8, PRA1.F3 PRENYLATED RAB ACCEPTOR 1.F3, PRA1 (Prenylated rab acceptor) family protein (.1)
AT1G55190 71 / 5e-15 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
AT4G00005 67 / 5e-14 PRA1 (Prenylated rab acceptor) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G104400 258 / 1e-87 AT2G38360 206 / 5e-67 prenylated RAB acceptor 1.B4 (.1)
Potri.008G074000 191 / 3e-61 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Potri.008G074033 191 / 3e-61 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Potri.010G183300 181 / 1e-57 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2)
Potri.019G124100 158 / 1e-48 AT5G05380 140 / 8e-42 prenylated RAB acceptor 1.B3 (.1)
Potri.005G219100 97 / 1e-24 AT1G55190 132 / 8e-39 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.002G044000 96 / 2e-24 AT1G55190 130 / 4e-38 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.005G054700 87 / 5e-21 AT1G08770 137 / 1e-40 prenylated RAB acceptor 1.E (.1)
Potri.002G043800 82 / 3e-19 AT1G55190 136 / 1e-40 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012224 210 / 1e-68 AT2G38360 310 / 3e-108 prenylated RAB acceptor 1.B4 (.1)
Lus10002853 204 / 9e-66 AT2G38360 305 / 4e-106 prenylated RAB acceptor 1.B4 (.1)
Lus10017425 190 / 7e-61 AT2G38360 281 / 9e-97 prenylated RAB acceptor 1.B4 (.1)
Lus10007533 189 / 2e-60 AT2G38360 281 / 6e-97 prenylated RAB acceptor 1.B4 (.1)
Lus10009842 184 / 2e-58 AT2G38360 278 / 1e-95 prenylated RAB acceptor 1.B4 (.1)
Lus10042246 174 / 5e-54 AT2G38360 250 / 4e-84 prenylated RAB acceptor 1.B4 (.1)
Lus10026404 168 / 2e-52 AT2G38360 253 / 5e-86 prenylated RAB acceptor 1.B4 (.1)
Lus10022680 152 / 8e-47 AT2G38360 232 / 1e-78 prenylated RAB acceptor 1.B4 (.1)
Lus10014234 102 / 3e-27 AT2G38360 164 / 1e-51 prenylated RAB acceptor 1.B4 (.1)
Lus10024861 86 / 2e-20 AT1G08770 132 / 2e-38 prenylated RAB acceptor 1.E (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03208 PRA1 PRA1 family protein
Representative CDS sequence
>Potri.016G126400.1 pacid=42809838 polypeptide=Potri.016G126400.1.p locus=Potri.016G126400 ID=Potri.016G126400.1.v4.1 annot-version=v4.1
ATGTCGTCTCAATCTCCGCCAGTCCTCCCTATCACAAACCTCCAACCAACCACCACCACCACCACCACCGCTACAGCTTCCCAACCACCACTCCCTCCAC
ACGCCTTACGCGCATTCCTTAACAACATAACCGAATCCGTCCGCAACGGCTTCTCCCAACGCCGCCCCTTTACCGAACTAATCGACCGATCCGCTTTCTC
CAAACCCGAATCCATATCCGAAGCCACAACCCGGATCCGCAAAAACTACGCCTATTTCCGCATCAATTACCTCGCCGCCATTTTCGTAATCCTCGCATTC
TCCCTCCTTACTAACCCCTTCTCCCTCCTCCTCCTCGTCGGTCTCCTCTGCTCCTGGCTTTTCTTGTATCTCTTCCGCGCTTCCGATCAGCCTCTGGTCC
TCTTCGGCCGGACATTCAGTGACCGTGAAACGCTCGGGATTCTAATCGTTCTGAGCGTTTTCGTGGTTTTTCTAACGAACGTTGGATCAGTGATCATCTC
GGCGCTTTTGGTCGGTGTGGGGATTGTCTGTGCTCATGGCGCTTTTCGTGTTCCTGAGGATCTTTTCTTGGATGATGTTCAAGAAAACGCGAGTACAGGG
TTCTTGTCTTCATTCCTCGGTGGCGCTGCCTCTAATGTTGTCGCCTCCGCCGCTCCTATTGTGGCTGCCGCCCGTGCTTGA
AA sequence
>Potri.016G126400.1 pacid=42809838 polypeptide=Potri.016G126400.1.p locus=Potri.016G126400 ID=Potri.016G126400.1.v4.1 annot-version=v4.1
MSSQSPPVLPITNLQPTTTTTTTATASQPPLPPHALRAFLNNITESVRNGFSQRRPFTELIDRSAFSKPESISEATTRIRKNYAYFRINYLAAIFVILAF
SLLTNPFSLLLLVGLLCSWLFLYLFRASDQPLVLFGRTFSDRETLGILIVLSVFVVFLTNVGSVIISALLVGVGIVCAHGAFRVPEDLFLDDVQENASTG
FLSSFLGGAASNVVASAAPIVAAARA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 (... Potri.016G126400 0 1
AT5G06390 FLA17 FASCICLIN-like arabinogalactan... Potri.016G066500 2.00 0.7442
AT1G72790 hydroxyproline-rich glycoprote... Potri.001G198900 3.46 0.7489
AT2G05590 TLD-domain containing nucleola... Potri.010G065900 8.36 0.5973
AT5G57510 unknown protein Potri.006G273566 12.00 0.6922
AT3G54690 SETH3 Sugar isomerase (SIS) family p... Potri.002G037400 17.91 0.7139
AT3G53620 ATPPA4 pyrophosphorylase 4 (.1) Potri.006G082500 20.78 0.6368
AT5G63770 ATDGK2 diacylglycerol kinase 2 (.1.2) Potri.007G097900 24.16 0.6735
AT5G22070 Core-2/I-branching beta-1,6-N-... Potri.001G215400 25.45 0.6226
AT5G57510 unknown protein Potri.006G273500 26.68 0.7039
AT3G21220 ATMAP2K_ALPHA, ... ARABIDOPSIS THALIANA MITOGEN-A... Potri.010G249300 34.39 0.6351 MKK4.1

Potri.016G126400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.