Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G01650 193 / 2e-65 Tautomerase/MIF superfamily protein (.1.2) AT5G57170 144 / 4e-46 Tautomerase/MIF superfamily protein (.1.2) AT3G51660 112 / 3e-33 Tautomerase/MIF superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G104500 [exp] 209 / 1e-71 AT5G01650 200 / 5e-68 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126600 [exp] 191 / 1e-64 AT5G01650 216 / 2e-74 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126800 [exp] 184 / 7e-62 AT5G01650 185 / 4e-62 Tautomerase/MIF superfamily protein (.1.2) Potri.006G104600 [exp] 177 / 5e-59 AT5G01650 180 / 3e-60 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126700 [exp] 165 / 4e-54 AT5G01650 164 / 6e-54 Tautomerase/MIF superfamily protein (.1.2) Potri.006G075100 [exp] 139 / 5e-44 AT5G57170 194 / 7e-66 Tautomerase/MIF superfamily protein (.1.2) Potri.006G104800 [exp] 126 / 7e-39 AT3G51660 151 / 7e-49 Tautomerase/MIF superfamily protein (.1) Potri.016G127300 [exp] 125 / 1e-38 AT3G51660 151 / 7e-49 Tautomerase/MIF superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022681 [exp] 160 / 4e-52 AT5G01650 172 / 8e-57 Tautomerase/MIF superfamily protein (.1.2) Lus10014233 [exp] 154 / 8e-50 AT5G01650 169 / 1e-55 Tautomerase/MIF superfamily protein (.1.2) Lus10012223 [exp] 131 / 7e-41 AT5G01650 146 / 9e-47 Tautomerase/MIF superfamily protein (.1.2) Lus10012222 [exp] 124 / 9e-38 AT3G51660 158 / 1e-51 Tautomerase/MIF superfamily protein (.1) Lus10033324 [exp] 97 / 9e-27 AT5G57170 119 / 1e-35 Tautomerase/MIF superfamily protein (.1.2) Lus10034783 [exp] 92 / 8e-25 AT5G57170 116 / 4e-34 Tautomerase/MIF superfamily protein (.1.2) Lus10000344 [exp] 80 / 9e-21 AT3G51660 96 / 2e-27 Tautomerase/MIF superfamily protein (.1) Lus10000345 [exp] 56 / 2e-10 AT5G01650 52 / 2e-11 Tautomerase/MIF superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0082 [poplar] [flax] MIF PF01187 [poplar] [flax] MIF Macrophage migration inhibitory factor (MIF)
Representative CDS sequence Show only first row Show all	>Potri.016G126500.3 pacid=42810432 polypeptide=Potri.016G126500.3.p locus=Potri.016G126500 ID=Potri.016G126500.3.v4.1 annot-version=v4.1 ATGCCTTGCTTGAACATTTCGACGAACGTTAATCTTGATGGCGTCAACACATCTGCCATCCTCTCCGAAGCCTCCTCTCAGGTCGCCAAAATCATCAAGA AACCTGAGTCTTATGTGATGATTGTGTTGAAGGGCTCGGTTCCAATTTCATTTGGAGGAACTGAGGAGCCAGCAGCTTATGGTGAATTGGTATCTATCGG TGGCCTTAGCAGTGATGTGAACAAGAAATTGAGTTCTGCAATTTCAACTATTCTTTTGTCAAAGCTGTCGGTGCCCAAGTCCCGGTTCTTCCTCAAGTTT TATGATGTCCAGCGCTCCCACCTTGGTTGGAATGGTTCCACCTTCTAA
AA sequence Show only first row Show all	>Potri.016G126500.3 pacid=42810432 polypeptide=Potri.016G126500.3.p locus=Potri.016G126500 ID=Potri.016G126500.3.v4.1 annot-version=v4.1 MPCLNISTNVNLDGVNTSAILSEASSQVAKIIKKPESYVMIVLKGSVPISFGGTEEPAAYGELVSIGGLSSDVNKKLSSAISTILLSKLSVPKSRFFLKF YDVQRSHLGWNGSTF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G01650			Tautomerase/MIF superfamily pr...		Potri.016G126500 [exp]	0	1
AT1G18335			Acyl-CoA N-acyltransferases (N...		Potri.012G041400 [exp]	9.27	0.7014
AT1G05070			Protein of unknown function (D...		Potri.005G038000 [exp]	10.19	0.6767
AT1G66520		PDE194	pigment defective 194, formylt...		Potri.017G123300 [exp]	17.74	0.6534
AT1G47820			unknown protein		Potri.014G121300 [exp]	21.54	0.6529
AT5G40500			unknown protein		Potri.001G344700 [exp]	22.95	0.6047
AT1G14300			ARM repeat superfamily protein...		Potri.013G124050 [exp]	22.97	0.6412
AT1G16080			unknown protein		Potri.001G040100 [exp]	26.70	0.5824
AT3G54560		HTA11	histone H2A 11 (.1)		Potri.005G216600 [exp]	37.81	0.6317	HTA905
AT3G23600			alpha/beta-Hydrolases superfam...		Potri.008G201400 [exp]	38.06	0.6014
AT5G38360			alpha/beta-Hydrolases superfam...		Potri.004G099300 [exp]	42.84	0.6329

Compare expression of checked genes

Potri.016G126500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.