Potri.016G127300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G51660 151 / 7e-49 Tautomerase/MIF superfamily protein (.1)
AT5G01650 130 / 2e-40 Tautomerase/MIF superfamily protein (.1.2)
AT5G57170 96 / 8e-27 Tautomerase/MIF superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G104800 219 / 8e-76 AT3G51660 151 / 7e-49 Tautomerase/MIF superfamily protein (.1)
Potri.006G104500 128 / 1e-39 AT5G01650 200 / 5e-68 Tautomerase/MIF superfamily protein (.1.2)
Potri.016G126500 125 / 1e-38 AT5G01650 193 / 2e-65 Tautomerase/MIF superfamily protein (.1.2)
Potri.016G126600 125 / 1e-38 AT5G01650 216 / 2e-74 Tautomerase/MIF superfamily protein (.1.2)
Potri.016G126800 123 / 1e-37 AT5G01650 185 / 4e-62 Tautomerase/MIF superfamily protein (.1.2)
Potri.006G104600 118 / 7e-36 AT5G01650 180 / 3e-60 Tautomerase/MIF superfamily protein (.1.2)
Potri.016G126700 110 / 2e-32 AT5G01650 164 / 6e-54 Tautomerase/MIF superfamily protein (.1.2)
Potri.006G075100 97 / 4e-27 AT5G57170 194 / 7e-66 Tautomerase/MIF superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012222 170 / 4e-56 AT3G51660 158 / 1e-51 Tautomerase/MIF superfamily protein (.1)
Lus10022681 117 / 3e-35 AT5G01650 172 / 8e-57 Tautomerase/MIF superfamily protein (.1.2)
Lus10014233 115 / 2e-34 AT5G01650 169 / 1e-55 Tautomerase/MIF superfamily protein (.1.2)
Lus10000344 99 / 1e-28 AT3G51660 96 / 2e-27 Tautomerase/MIF superfamily protein (.1)
Lus10012223 97 / 2e-27 AT5G01650 146 / 9e-47 Tautomerase/MIF superfamily protein (.1.2)
Lus10033324 62 / 4e-13 AT5G57170 119 / 1e-35 Tautomerase/MIF superfamily protein (.1.2)
Lus10034783 59 / 1e-11 AT5G57170 116 / 4e-34 Tautomerase/MIF superfamily protein (.1.2)
Lus10000345 37 / 0.001 AT5G01650 52 / 2e-11 Tautomerase/MIF superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0082 MIF PF01187 MIF Macrophage migration inhibitory factor (MIF)
Representative CDS sequence
>Potri.016G127300.1 pacid=42809026 polypeptide=Potri.016G127300.1.p locus=Potri.016G127300 ID=Potri.016G127300.1.v4.1 annot-version=v4.1
ATGCCTTGCCTTTATATCTCCACCAATGTCAACCTTGATGATGTTGACAAGGATCCCATCTTTTCCGAGGCCACAAAAGCTGTTGCTTCCATCATCGGAA
GACCTGAACATCTTGTGATGGTCATACTTAAAGGAACCTTGGGCATATCATTCAATGGAAACAAGGAACCAGCTGCATACGCAGAGATAGTGTCGATGGG
TGGGATTACCAAACAAGTTAAGAGGAATCTGATCGCTACCCTTGGAACAATTCTTGAGGCAAAGTTATCCATCCCCAGGGCACGATTCTTCCTCAAAGTT
TATGATACAACAGCTGCTGGCAACTGCTCCAAGTTGTAA
AA sequence
>Potri.016G127300.1 pacid=42809026 polypeptide=Potri.016G127300.1.p locus=Potri.016G127300 ID=Potri.016G127300.1.v4.1 annot-version=v4.1
MPCLYISTNVNLDDVDKDPIFSEATKAVASIIGRPEHLVMVILKGTLGISFNGNKEPAAYAEIVSMGGITKQVKRNLIATLGTILEAKLSIPRARFFLKV
YDTTAAGNCSKL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G51660 Tautomerase/MIF superfamily pr... Potri.016G127300 0 1
AT1G01050 ATPPA1 pyrophosphorylase 1 (.1) Potri.007G022700 28.84 0.7902
AT5G39050 PMAT1 phenolic glucoside malonyltran... Potri.004G103100 34.39 0.7727
AT3G18280 Bifunctional inhibitor/lipid-t... Potri.004G096000 64.42 0.7627
AT2G33590 NAD(P)-binding Rossmann-fold s... Potri.002G004100 73.97 0.7974
AT1G07570 APK1A Protein kinase superfamily pro... Potri.001G240400 141.68 0.7559 Pt-APK1.2
AT1G22540 Major facilitator superfamily ... Potri.013G106600 194.76 0.7483
AT2G26640 KCS11 3-ketoacyl-CoA synthase 11 (.1... Potri.010G080000 215.40 0.7630
AT3G51970 ATASAT1, ASAT1,... ARABIDOPSIS THALIANA STEROL O-... Potri.009G055000 240.48 0.7512

Potri.016G127300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.