Potri.016G132700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G05340 367 / 2e-127 Peroxidase superfamily protein (.1)
AT5G58400 332 / 1e-113 Peroxidase superfamily protein (.1)
AT5G58390 327 / 5e-112 Peroxidase superfamily protein (.1)
AT1G14550 296 / 9e-100 Peroxidase superfamily protein (.1)
AT4G36430 293 / 4e-98 Peroxidase superfamily protein (.1)
AT3G50990 288 / 4e-96 Peroxidase superfamily protein (.1)
AT4G16270 287 / 1e-95 Peroxidase superfamily protein (.1)
AT1G14540 286 / 1e-95 Peroxidase superfamily protein (.1)
AT5G06720 286 / 2e-95 ATPA2 peroxidase 2 (.1)
AT2G18150 284 / 1e-94 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G154400 412 / 2e-145 AT5G05340 363 / 3e-126 Peroxidase superfamily protein (.1)
Potri.013G083600 371 / 3e-129 AT5G05340 483 / 2e-173 Peroxidase superfamily protein (.1)
Potri.013G156500 369 / 2e-128 AT5G05340 441 / 1e-156 Peroxidase superfamily protein (.1)
Potri.006G107000 344 / 1e-118 AT5G05340 349 / 2e-120 Peroxidase superfamily protein (.1)
Potri.014G143200 343 / 2e-118 AT5G05340 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.013G156400 340 / 2e-116 AT5G05340 412 / 1e-144 Peroxidase superfamily protein (.1)
Potri.010G236910 335 / 3e-115 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.010G236850 335 / 3e-115 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.016G132900 333 / 4e-114 AT5G05340 350 / 6e-121 Peroxidase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006534 371 / 5e-129 AT5G05340 399 / 3e-140 Peroxidase superfamily protein (.1)
Lus10000346 363 / 8e-125 AT5G05340 394 / 8e-137 Peroxidase superfamily protein (.1)
Lus10034207 359 / 2e-124 AT5G05340 454 / 8e-162 Peroxidase superfamily protein (.1)
Lus10009937 351 / 2e-121 AT5G05340 347 / 6e-120 Peroxidase superfamily protein (.1)
Lus10003573 342 / 5e-118 AT5G05340 397 / 1e-139 Peroxidase superfamily protein (.1)
Lus10032786 341 / 2e-117 AT5G05340 403 / 1e-141 Peroxidase superfamily protein (.1)
Lus10008581 336 / 1e-115 AT5G05340 367 / 6e-128 Peroxidase superfamily protein (.1)
Lus10030148 335 / 2e-115 AT5G05340 410 / 3e-145 Peroxidase superfamily protein (.1)
Lus10024209 334 / 3e-114 AT1G14550 432 / 3e-153 Peroxidase superfamily protein (.1)
Lus10025256 320 / 7e-109 AT5G05340 290 / 4e-97 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Potri.016G132700.1 pacid=42810187 polypeptide=Potri.016G132701.1.p locus=Potri.016G132700 ID=Potri.016G132700.1.v4.1 annot-version=v4.1
ATGGCTTCTTTTAACTCTTCCTCATCAACCATCACTACCTTCAAATTCCATTTTGGGGCATTTCTGCTTCTTGTTGGTGTTGCTTCTGCTCAATTAGCTT
CAAACTTCTATGGAACATCATGCCCCAGTGTCCTTTCTGTCATTAAATCAGCTGTTGACTCAGCAGTGTCAAATGAGGCTCGCATGGGGGCATCCTTGCT
CCGTCTTCATTTCCATGATTGCTTTGTTAATGGGTGTGATGCATCAGTGCTTTTGGACGGTGGAGAAAAGACAGCACCAGCAAATACTAATTCTCTGAGA
GGTTTCGAAGTTATTGACAGTATTAAAACTCAATTAGAGAGTTCCTGCCCTGGTGTTGTGTCCTGTGCTGACATCTTATCTGTTGCTGCTCGGGACTCTG
TTGTTGCTTTGGGTGGTCCTAGTTGGCAAGTTCAATTGGGCAGGAGAGATTCAGCCACAGCAGGAAGTGTTAGCGATGTTAATAACAACGTCCCTTCCCC
AGCCTTGAGTGTCAGTGGCCTCATCTCTGCCTTCTCCAACAAAGGTTTCACAGCTAAAGAAATGGTGGCTCTTTCTGGATCTCACACAATAGGGCAAGCA
AGATGTACCACATTCCTAACCAGAATCAACAATGAAACCAACATAGATTCCTCGTTCAAAACATCAACACAAGCTCAATGTCAGAATACTAACAATTTTG
TTCCTTTGGATGTCACGAGCCCAACATCTTTCGACAGTGCTTACTACAGGAACTTACTGAACCAAAAGGGTCTTTTACACTCTGACCAGCAACTCTTTAG
TGGGGGCTCTACAGATGCTCAAGTTAGGGCTTATAGCTCTAATCAGGCTGCTTTCAGGACAGACTTTGCAAATGCAATGATAAAGATGGGAAACCTTAGC
CCACTTACTGGCACAAATGGCCAGATCAGGACCAATTGCAGGAAGGCCAATTGA
AA sequence
>Potri.016G132700.1 pacid=42810187 polypeptide=Potri.016G132701.1.p locus=Potri.016G132700 ID=Potri.016G132700.1.v4.1 annot-version=v4.1
MASFNSSSSTITTFKFHFGAFLLLVGVASAQLASNFYGTSCPSVLSVIKSAVDSAVSNEARMGASLLRLHFHDCFVNGCDASVLLDGGEKTAPANTNSLR
GFEVIDSIKTQLESSCPGVVSCADILSVAARDSVVALGGPSWQVQLGRRDSATAGSVSDVNNNVPSPALSVSGLISAFSNKGFTAKEMVALSGSHTIGQA
RCTTFLTRINNETNIDSSFKTSTQAQCQNTNNFVPLDVTSPTSFDSAYYRNLLNQKGLLHSDQQLFSGGSTDAQVRAYSSNQAAFRTDFANAMIKMGNLS
PLTGTNGQIRTNCRKAN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G05340 Peroxidase superfamily protein... Potri.016G132700 0 1
AT2G26640 KCS11 3-ketoacyl-CoA synthase 11 (.1... Potri.008G160000 7.54 0.8755
AT1G03220 Eukaryotic aspartyl protease f... Potri.008G203200 9.16 0.8323
AT1G34110 Leucine-rich receptor-like pro... Potri.005G198000 14.07 0.8427
AT3G54960 ATPDI1, ATPDIL1... ARABIDOPSIS THALIANA PROTEIN D... Potri.010G222100 15.62 0.8637
AT3G45070 P-loop containing nucleoside t... Potri.010G138400 17.32 0.8177
AT4G02370 Protein of unknown function, D... Potri.014G127500 22.62 0.8123
AT5G41040 HXXXD-type acyl-transferase fa... Potri.015G100800 24.08 0.8054
AT4G35160 O-methyltransferase family pro... Potri.013G121900 25.98 0.8530
AT1G01120 KCS1 3-ketoacyl-CoA synthase 1 (.1) Potri.002G178000 35.49 0.7981 Pt-KCS1.1
AT1G48960 Adenine nucleotide alpha hydro... Potri.012G059100 47.49 0.7798

Potri.016G132700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.