Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G55180 142 / 6e-40 O-Glycosyl hydrolases family 17 protein (.1.2) AT4G26830 140 / 2e-39 O-Glycosyl hydrolases family 17 protein (.1) AT2G05790 133 / 1e-36 O-Glycosyl hydrolases family 17 protein (.1) AT1G30080 122 / 6e-33 Glycosyl hydrolase superfamily protein (.1) AT5G56590 123 / 1e-32 O-Glycosyl hydrolases family 17 protein (.1) AT2G16230 118 / 7e-31 O-Glycosyl hydrolases family 17 protein (.1) AT5G20330 112 / 2e-29 BETAG4 "beta-1,3-glucanase 4", beta-1,3-glucanase 4 (.1) AT5G20390 110 / 6e-29 Glycosyl hydrolase superfamily protein (.1) AT3G57270 110 / 1e-28 BG1 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) AT4G16260 110 / 1e-28 Glycosyl hydrolase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G158400 [exp] 140 / 3e-39 AT2G05790 751 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.002G224600 [exp] 136 / 1e-37 AT2G05790 750 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.011G094400 [exp] 129 / 4e-35 AT5G55180 635 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.011G084900 [exp] 122 / 1e-32 AT1G30080 538 / 0.0 Glycosyl hydrolase superfamily protein (.1) Potri.006G046100 [exp] 117 / 2e-31 AT3G57270 370 / 4e-128 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) Potri.012G017800 [exp] 117 / 1e-30 AT5G24318 583 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.010G108500 [exp] 115 / 1e-29 AT2G01630 708 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.002G007300 [exp] 115 / 1e-29 AT4G29360 339 / 1e-111 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.018G068600 [exp] 114 / 2e-29 AT5G56590 685 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029149 [exp] 236 / 3e-77 AT5G55180 271 / 2e-87 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10013016 [exp] 231 / 3e-75 AT5G55180 272 / 5e-88 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10015151 [exp] 132 / 6e-36 AT2G05790 731 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10040600 [exp] 129 / 8e-35 AT5G55180 630 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10032562 [exp] 128 / 1e-34 AT5G55180 642 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10014110 [exp] 123 / 8e-34 AT3G57270 359 / 2e-124 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) Lus10018306 [exp] 122 / 1e-32 AT5G55180 632 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10004391 [exp] 121 / 5e-32 AT5G55180 602 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10034987 [exp] 120 / 5e-32 AT5G56590 562 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10031037 [exp] 119 / 6e-32 AT3G57240 312 / 3e-105 "beta-1,3-glucanase 3", beta-1,3-glucanase 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [poplar] [flax] Glyco_hydro_tim PF00332 [poplar] [flax] Glyco_hydro_17 Glycosyl hydrolases family 17
Representative CDS sequence Show only first row Show all	>Potri.016G135900.2 pacid=42810451 polypeptide=Potri.016G135900.2.p locus=Potri.016G135900 ID=Potri.016G135900.2.v4.1 annot-version=v4.1 ATGGTTGACATTCCTAATGAAGATCTCCCTTCTCTTGCCACTGGCACCCTCAACTTCTCTCTTGAATGGCTTCAATCCAATATTTTCTCAAATATCCCCA CTGCCCAAGTCAAATACATTGCTGTTGGAAACGAAGTCTTTCTCAAAGATCCATTCTACACTCCTTATTATATTAAGTTATCATCACCTCAAGCGGCATC TGTGCTCTCTCTTTCATACCCTCCATCATCTACAGCATTTGACCCTTATCTCCATTCTGTTATGATCCCTCTTATGAAATTTCTACATGACACTGGATCT CCTTTCATGGTCAATGAACATATATCATTAGATTATGCCTTGTTTAGAAACCAAAACGTAGCGCAAGATGGTGGATTCTTGTATGCTAATCTTTTGGATG CTAGCGTTGATGCATTTGCGTATGCAATGGAGAGAGAGGGATTTCAAGGGATTAAGATTGTTGTATCAGAAACAGGGTGGGCAACTGGTGGCGGCGAGGC AGCAAGTGTGGCTAATGCAATGGCGTACAACGAGAATGTGGTAAGACGAGTGGCGAATTATGTCGGCACCCCGAGACAGCCAAATGAAGAAATGGAAGTT TACTTATTTGATCTCTTTGATGAGAATGAGAAAAATGGGGAGGAGTTTACTTAA
AA sequence Show only first row Show all	>Potri.016G135900.2 pacid=42810451 polypeptide=Potri.016G135900.2.p locus=Potri.016G135900 ID=Potri.016G135900.2.v4.1 annot-version=v4.1 MVDIPNEDLPSLATGTLNFSLEWLQSNIFSNIPTAQVKYIAVGNEVFLKDPFYTPYYIKLSSPQAASVLSLSYPPSSTAFDPYLHSVMIPLMKFLHDTGS PFMVNEHISLDYALFRNQNVAQDGGFLYANLLDASVDAFAYAMEREGFQGIKIVVSETGWATGGGEAASVANAMAYNENVVRRVANYVGTPRQPNEEMEV YLFDLFDENEKNGEEFT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G55180			O-Glycosyl hydrolases family 1...		Potri.016G135900 [exp]	0	1
AT5G60900		RLK1	receptor-like protein kinase 1...		Potri.003G211866 [exp]	4.47	1.0000
AT4G02270		RHS13	root hair specific 13 (.1)		Potri.002G201800 [exp]	6.00	0.9116
AT1G70500			Pectin lyase-like superfamily ...		Potri.015G088600 [exp]	6.00	1.0000
					Potri.001G426850 [exp]	6.48	0.9569
AT5G61620	MYB		myb-like transcription factor ...		Potri.001G080300 [exp]	8.00	0.9339
AT1G64870			unknown protein		Potri.014G054900 [exp]	8.36	0.9043
AT5G56360		PSL4	PRIORITY IN SWEET LIFE 4, calm...		Potri.013G060332 [exp]	10.24	0.8211
AT5G27660			Trypsin family protein with PD...		Potri.018G001550 [exp]	10.48	0.8917
AT2G32990		ATGH9B8	glycosyl hydrolase 9B8 (.1)		Potri.001G356000 [exp]	13.07	0.7512
					Potri.018G064450 [exp]	16.91	0.6757

Compare expression of checked genes

Potri.016G135900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.