Plant FIBer expression Database

Potri.016G140250 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G044250
[exp]
60 / 4e-12 ND /
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.016G140250.1 pacid=42809328 polypeptide=Potri.016G140250.1.p locus=Potri.016G140250 ID=Potri.016G140250.1.v4.1 annot-version=v4.1
ATGGCAGAAAAAAGGATCAATTTATCCTCAGTATGGACAAATGCCACATTATCTGAGAAAGTTTTGTCCACTATTTATGGACTAACTTCTTCTCGCCAAT
TATGGACCGCCTTGGCTAATCGCTTTGCACCTCCCTCTCCCTCCCGCATCTCCCATCTCAAAAGACTCTTCTACAGACCTCGACAGCCCTGCCAAATTTA
TGGCAAAACAAATCACCAAGCACTCGACTGCTATAACAGGATGCATTTTTCTTACCAAGGGCGTCATCCTCCATCTCAACTTGCAGCATTAACAGCCCAA
TCAAATGTCCACATCACAGATGATCTTGACCACTTATCTCTGTAA
AA sequence
>Potri.016G140250.1 pacid=42809328 polypeptide=Potri.016G140250.1.p locus=Potri.016G140250 ID=Potri.016G140250.1.v4.1 annot-version=v4.1
MAEKRINLSSVWTNATLSEKVLSTIYGLTSSRQLWTALANRFAPPSPSRISHLKRLFYRPRQPCQIYGKTNHQALDCYNRMHFSYQGRHPPSQLAALTAQ
SNVHITDDLDHLSL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.016G140250
[exp]
0 1
AT5G36970 NHL25 NDR1/HIN1-like 25 (.1) Potri.012G145500
[exp]
1.73 0.9315 NHL25.1
AT1G13340 Regulator of Vps4 activity in ... Potri.004G100900
[exp]
2.82 0.8949
AT5G39040 AtALS1, ABCB27,... ARABIDOPSIS THALIANA TRANSPORT... Potri.015G059700
[exp]
3.46 0.8817
AT2G26560 PLP2, PLAIIA, P... PATATIN-LIKE PROTEIN 2, phosph... Potri.014G033200
[exp]
3.87 0.9104
AT2G24720 ATGLR2.2 glutamate receptor 2.2 (.1) Potri.018G096300
[exp]
7.41 0.8872
Potri.011G047200
[exp]
7.48 0.8778
AT1G69490 NAC NAP, ANAC029, A... Arabidopsis NAC domain contain... Potri.008G089000
[exp]
12.64 0.8594
AT1G14870 AtPCR2, PCR2 PLANT CADMIUM RESISTANCE 2 (.1... Potri.010G108900
[exp]
13.41 0.8611
AT3G16030 CES101 CALLUS EXPRESSION OF RBCS 101,... Potri.001G442200
[exp]
15.42 0.8292
AT5G05320 FAD/NAD(P)-binding oxidoreduct... Potri.019G003500
[exp]
17.66 0.8624

Potri.016G140250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.