Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G20780 197 / 3e-64 CML42 calmodulin like 42 (.1) AT5G44460 191 / 3e-62 CML43 calmodulin like 43 (.1) AT2G43290 91 / 2e-22 MSS3 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1) AT1G05990 86 / 3e-21 RHS1 ,RHS2 ROOT HAIR SPECIFIC 1, EF hand calcium-binding protein family (.1) AT4G03290 84 / 1e-20 EF hand calcium-binding protein family (.1) AT3G59440 85 / 2e-20 Calcium-binding EF-hand family protein (.1) AT1G66400 77 / 5e-18 CML23 calmodulin like 23 (.1) AT5G37770 76 / 2e-17 CML24, TCH2 TOUCH 2, CALMODULIN-LIKE 24, EF hand calcium-binding protein family (.1) AT3G07490 73 / 2e-16 AtCML3, AGD11 calmodulin-like 3, ARF-GAP domain 11 (.1) AT1G24620 72 / 1e-15 EF hand calcium-binding protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G112500 [exp] 263 / 2e-90 AT4G20780 238 / 2e-80 calmodulin like 42 (.1) Potri.017G029700 [exp] 89 / 6e-22 AT3G07490 192 / 1e-62 calmodulin-like 3, ARF-GAP domain 11 (.1) Potri.002G077300 [exp] 85 / 8e-21 AT1G21550 123 / 3e-36 Calcium-binding EF-hand family protein (.1) Potri.007G128600 [exp] 86 / 1e-20 AT2G43290 218 / 3e-72 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1) Potri.005G183300 [exp] 78 / 3e-18 AT1G21550 136 / 1e-41 Calcium-binding EF-hand family protein (.1) Potri.002G239100 [exp] 78 / 3e-18 AT3G07490 248 / 8e-86 calmodulin-like 3, ARF-GAP domain 11 (.1) Potri.007G042900 [exp] 79 / 5e-18 AT2G15680 169 / 1e-53 calmodulin-like 30, Calcium-binding EF-hand family protein (.1) Potri.006G065900 [exp] 78 / 1e-17 AT3G07490 131 / 1e-38 calmodulin-like 3, ARF-GAP domain 11 (.1) Potri.010G080900 [exp] 72 / 3e-16 AT4G14640 270 / 2e-94 calmodulin-like 8, calmodulin 8 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003239 [exp] 217 / 4e-72 AT4G20780 249 / 5e-85 calmodulin like 42 (.1) Lus10021134 [exp] 210 / 2e-69 AT4G20780 236 / 8e-80 calmodulin like 42 (.1) Lus10035611 [exp] 210 / 3e-69 AT4G20780 242 / 3e-82 calmodulin like 42 (.1) Lus10017174 [exp] 206 / 2e-67 AT4G20780 234 / 4e-79 calmodulin like 42 (.1) Lus10027701 [exp] 83 / 2e-19 AT2G43290 153 / 2e-46 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1) Lus10000972 [exp] 81 / 3e-19 AT1G21550 128 / 3e-38 Calcium-binding EF-hand family protein (.1) Lus10028657 [exp] 81 / 9e-19 AT1G21550 122 / 9e-36 Calcium-binding EF-hand family protein (.1) Lus10009564 [exp] 78 / 3e-18 AT3G07490 233 / 7e-80 calmodulin-like 3, ARF-GAP domain 11 (.1) Lus10006644 [exp] 77 / 8e-17 AT3G07490 148 / 3e-45 calmodulin-like 3, ARF-GAP domain 11 (.1) Lus10038088 [exp] 75 / 3e-16 AT3G07490 150 / 7e-46 calmodulin-like 3, ARF-GAP domain 11 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF13405 [poplar] [flax] EF-hand_6 EF-hand domain CL0220 [poplar] [flax] EF_hand PF13499 [poplar] [flax] EF-hand_7 EF-hand domain pair
Representative CDS sequence Show only first row Show all	>Potri.016G142000.1 pacid=42810192 polypeptide=Potri.016G142000.1.p locus=Potri.016G142000 ID=Potri.016G142000.1.v4.1 annot-version=v4.1 ATGGAAGCAGCAGCAGCAGCAGCAGCAGCCTCTGCCTCTGCCTCTGCCTCTGCCAGACACAAGAAATCCTCCTCCTTTAGTCTACGTAGCCCCAGTCTCA ATTCCCTTCGCCTCCGCCGCATTTTTGATCTTTTCGACAAGAATGGCGATGGCATGATCACCATCCAGGAAATTAGTCAAGCACTCAGCCTTCTTGGCCT CGACGCTGACTTCTCTGAGCTTGAATTCACCATCAAATCCCACATTAAGCCAGACAACAATGGCCTTTCTTTCGAAGATTTCGTGTCCCTTCATCAATCA TTGCACAACAGTTTCTTTGGTTACGATAATAATGCGGCCGAGGAGGAGGCGTCTGCGAATGATATTGGAGATCAAGCTTGGATGAGAATGGAGGAATCTG ATTTGTCAGAGGCATTCAAGGTTTTCGACGAGGATGGGGATGGTTACATATCAGCACATGAACTGCAAGTGGTCTTGAGGAAGTTGGGATTTCCTGAAGC CAAAGAGATTGACAGAATTCAGAAGATGATCATCACTGTCGACAGCAACCATGATGGTCGTGTTGATTTCTTTGAATTTAAGGAAATGATGAGGAGCGTT CTTGTTAGGAGCTCTTAA
AA sequence Show only first row Show all	>Potri.016G142000.1 pacid=42810192 polypeptide=Potri.016G142000.1.p locus=Potri.016G142000 ID=Potri.016G142000.1.v4.1 annot-version=v4.1 MEAAAAAAAASASASASARHKKSSSFSLRSPSLNSLRLRRIFDLFDKNGDGMITIQEISQALSLLGLDADFSELEFTIKSHIKPDNNGLSFEDFVSLHQS LHNSFFGYDNNAAEEEASANDIGDQAWMRMEESDLSEAFKVFDEDGDGYISAHELQVVLRKLGFPEAKEIDRIQKMIITVDSNHDGRVDFFEFKEMMRSV LVRSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G20780		CML42	calmodulin like 42 (.1)		Potri.016G142000 [exp]	0	1
AT1G58290		AtHEMA1, HEMA1	Arabidopsis thaliana hemA 1, G...		Potri.009G080600 [exp]	2.82	0.9626
AT4G39830			Cupredoxin superfamily protein...		Potri.007G088358 [exp]	3.16	0.9563
					Potri.016G134100 [exp]	5.65	0.9440
AT3G16770	AP2_ERF	RAP2.03, ATEBP,...	RELATED TO AP2 3, ETHYLENE RES...		Potri.014G126100 [exp]	10.34	0.8661
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Potri.014G047000 [exp]	11.83	0.9431	ERF7
AT5G37490			ARM repeat superfamily protein...		Potri.015G031000 [exp]	12.48	0.9490
AT1G80840	WRKY	ATWRKY40, WRKY4...	WRKY DNA-binding protein 40 (....		Potri.003G182200 [exp]	14.49	0.9399	WRKY40.2
AT4G39830			Cupredoxin superfamily protein...		Potri.007G088290 [exp]	15.29	0.9291
					Potri.009G138850 [exp]	15.49	0.8873
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Potri.014G046600 [exp]	16.94	0.9343

Compare expression of checked genes

Potri.016G142000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.