Potri.016G143400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G01015 57 / 3e-11 unknown protein
AT1G65295 43 / 5e-06 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G113700 140 / 8e-44 AT5G01015 71 / 9e-17 unknown protein
Potri.019G053100 44 / 2e-06 AT1G65295 123 / 1e-37 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026997 42 / 2e-05 AT1G65295 113 / 9e-34 unknown protein
Lus10020197 42 / 2e-05 AT1G65295 114 / 7e-34 unknown protein
PFAM info
Representative CDS sequence
>Potri.016G143400.1 pacid=42810248 polypeptide=Potri.016G143400.1.p locus=Potri.016G143400 ID=Potri.016G143400.1.v4.1 annot-version=v4.1
ATGTATGTACATGAGCAGCTTTTGCATGCCTCCTCTCTGGCCTGTCAGCCGACATATATTATTGAGATGAATTATTCCACGAAACTAGCAGTATTAGTAT
TAGCAATCCTTTTGTTGATCATTGGTCCAGCTGTTGAGGCTTCTCCAGTAAACACATCGTTGAGTTCTACCGCAGGAGAATTCCGGCCTATGGAGGCAGC
TGAGTACAGGGTAATTGGAAGAAAGGGAGATGATGATTTGTGGAGAAGAAGGCTAGCACCTTTCCAGCTGTGTTTGCTATGCAAGTGCTGTGCTGGGGCA
GCAACCACCACCTGTGCCACCATGTCTTGCTGCTTCGGAATCGATTGCCGACTTCCTAACAAGCCTTATGGGGTTTGTGCTTTTGTACCTAAGACCTGTA
ATTGTACCTCTTGCGCTACTGTCTAG
AA sequence
>Potri.016G143400.1 pacid=42810248 polypeptide=Potri.016G143400.1.p locus=Potri.016G143400 ID=Potri.016G143400.1.v4.1 annot-version=v4.1
MYVHEQLLHASSLACQPTYIIEMNYSTKLAVLVLAILLLIIGPAVEASPVNTSLSSTAGEFRPMEAAEYRVIGRKGDDDLWRRRLAPFQLCLLCKCCAGA
ATTTCATMSCCFGIDCRLPNKPYGVCAFVPKTCNCTSCATV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G01015 unknown protein Potri.016G143400 0 1
AT3G47500 DOF CDF3, AtDof3,3 cycling DOF factor 3 (.1) Potri.004G121800 8.54 0.7534
AT5G06980 unknown protein Potri.001G031800 10.09 0.7463
AT5G10290 leucine-rich repeat transmembr... Potri.007G094500 12.48 0.7351
AT5G67360 ARA12 Subtilase family protein (.1) Potri.014G018900 12.80 0.7446
AT5G55530 Calcium-dependent lipid-bindin... Potri.011G088400 17.60 0.7438
AT1G16560 Per1-like family protein (.1.2... Potri.015G136600 19.49 0.7522
AT4G00150 GRAS ATHAM3, SCL6, L... LOST MERISTEMS 3, ARABIDOPSIS ... Potri.001G122800 33.10 0.7308
AT2G01490 phytanoyl-CoA dioxygenase (Phy... Potri.006G222800 33.94 0.6461
AT5G25830 GATA GATA12 GATA transcription factor 12 (... Potri.013G059600 35.09 0.7150
AT1G68910 WIT2 WPP domain-interacting protein... Potri.010G135900 38.47 0.6950

Potri.016G143400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.