Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G25970 157 / 3e-45 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G02010 97 / 4e-24 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G21065 94 / 3e-23 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT3G09040 93 / 9e-23 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G27110 93 / 1e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G13770 92 / 3e-22 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G15130 91 / 6e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G02330 90 / 1e-21 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G52630 90 / 1e-21 MEF1 mitochondrial RNAediting factor 1 (.1) AT3G61170 90 / 2e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G146800 [exp] 236 / 6e-75 AT3G25970 805 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G111300 [exp] 103 / 2e-26 AT3G02330 1077 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.010G136200 [exp] 95 / 2e-23 AT1G68930 997 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Potri.006G001200 [exp] 94 / 4e-23 AT3G24000 798 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.003G191000 [exp] 93 / 1e-22 AT1G11290 1178 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.016G053500 [exp] 91 / 5e-22 AT5G52630 785 / 0.0 mitochondrial RNAediting factor 1 (.1) Potri.005G187800 [exp] 89 / 2e-21 AT3G09040 1201 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.012G108000 [exp] 89 / 3e-21 AT2G34400 640 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.004G125500 [exp] 89 / 3e-21 AT3G29230 829 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004003 [exp] 157 / 6e-50 AT3G25970 164 / 6e-48 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10030249 [exp] 159 / 3e-46 AT3G25970 747 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10030581 [exp] 100 / 3e-25 AT1G68930 910 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10040504 [exp] 99 / 1e-24 AT3G13770 904 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10028953 [exp] 98 / 3e-24 AT5G47460 541 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10014594 [exp] 96 / 1e-23 AT3G02330 901 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10032091 [exp] 96 / 2e-23 AT3G02330 925 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10011323 [exp] 92 / 2e-22 AT5G52630 790 / 0.0 mitochondrial RNAediting factor 1 (.1) Lus10031994 [exp] 91 / 6e-22 AT3G02010 957 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10030908 [exp] 91 / 7e-22 AT1G68930 928 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF01535 [poplar] [flax] PPR PPR repeat CL0020 [poplar] [flax] TPR PF13041 [poplar] [flax] PPR_2 PPR repeat family
Representative CDS sequence Show only first row Show all	>Potri.017G001050.1 pacid=42813338 polypeptide=Potri.017G001050.1.p locus=Potri.017G001050 ID=Potri.017G001050.1.v4.1 annot-version=v4.1 ATGCCCCACAAAGACACCGTTACCTTGGACACCGTGATCACTGCCTATGTAGATTCTGGGAACTTGAGAGCTGCTTGGGATTTTCTAAAATCAATGAAAA GATGTGGCTTTCAAGCTGATGGCTATACCTTTGTAAGTATATTTAAAGGGGTAGCTCGTGCGTCTCGATATGATCTTGGTCAAAAAGTGCATTCCTTGAT TGTTAAGATCGGTTATGAACGGAATGTTTATGCGGGTAGCGCTTTATTGGACATGTATGCCGAGTGTGAAAGAGTTGAAGATGCTTATGATGTGTTTCGA GGCATGCCAACGCGTAATTTTATCTCGTGGAATGCACTCCTTGATGGCTTTGTGCAAGTGGGTGACCGTGACACTGCATTTTGGCTATTAGATTGGTGGA GAAGGAACGTGTTATGGTTGAAGATGGCACATTTGCTCCACTTTTGA
AA sequence Show only first row Show all	>Potri.017G001050.1 pacid=42813338 polypeptide=Potri.017G001050.1.p locus=Potri.017G001050 ID=Potri.017G001050.1.v4.1 annot-version=v4.1 MPHKDTVTLDTVITAYVDSGNLRAAWDFLKSMKRCGFQADGYTFVSIFKGVARASRYDLGQKVHSLIVKIGYERNVYAGSALLDMYAECERVEDAYDVFR GMPTRNFISWNALLDGFVQVGDRDTAFWLLDWWRRNVLWLKMAHLLHF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G25970			Pentatricopeptide repeat (PPR)...		Potri.017G001050 [exp]	0	1
					Potri.010G080633 [exp]	3.46	0.8779
AT5G14280	GeBP		DNA-binding storekeeper protei...		Potri.010G056000 [exp]	5.29	0.8586
AT2G27228		CPuORF6	conserved peptide upstream ope...		Potri.001G216800 [exp]	6.92	0.8431
AT5G52552		CPuORF14	conserved peptide upstream ope...		Potri.017G143300 [exp]	7.07	0.8246
AT1G58122		CPuORF45	conserved peptide upstream ope...		Potri.007G113150 [exp]	8.24	0.8310
AT2G16880			Pentatricopeptide repeat (PPR)...		Potri.008G044050 [exp]	10.09	0.8080
					Potri.005G187000 [exp]	10.58	0.8002
AT5G07900			Mitochondrial transcription te...		Potri.004G012300 [exp]	10.81	0.7958
AT2G31280	bHLH	bHLH155 ,CPuORF...	conserved peptide upstream ope...		Potri.006G090033 [exp]	12.32	0.7961
AT5G36930			Disease resistance protein (TI...		Potri.010G231250 [exp]	14.07	0.7857

Compare expression of checked genes

Potri.017G001050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.