Pt-COS1.2 (Potri.017G001800) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-COS1.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44050 291 / 1e-100 COS1 coronatine insensitive1 suppressor, COI1 SUPPRESSOR1, 6,7-dimethyl-8-ribityllumazine synthase / DMRL synthase / lumazine synthase / riboflavin synthase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G146000 359 / 1e-127 AT2G44050 279 / 6e-96 coronatine insensitive1 suppressor, COI1 SUPPRESSOR1, 6,7-dimethyl-8-ribityllumazine synthase / DMRL synthase / lumazine synthase / riboflavin synthase (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028541 287 / 8e-99 AT2G44050 288 / 2e-99 coronatine insensitive1 suppressor, COI1 SUPPRESSOR1, 6,7-dimethyl-8-ribityllumazine synthase / DMRL synthase / lumazine synthase / riboflavin synthase (.1)
Lus10018133 285 / 3e-98 AT2G44050 289 / 1e-99 coronatine insensitive1 suppressor, COI1 SUPPRESSOR1, 6,7-dimethyl-8-ribityllumazine synthase / DMRL synthase / lumazine synthase / riboflavin synthase (.1)
Lus10034145 279 / 8e-93 AT3G54300 322 / 4e-109 vesicle-associated membrane protein 727 (.1.2)
Lus10043431 271 / 4e-90 AT3G54300 325 / 9e-111 vesicle-associated membrane protein 727 (.1.2)
Lus10000192 164 / 1e-51 AT2G44050 148 / 1e-45 coronatine insensitive1 suppressor, COI1 SUPPRESSOR1, 6,7-dimethyl-8-ribityllumazine synthase / DMRL synthase / lumazine synthase / riboflavin synthase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Representative CDS sequence
>Potri.017G001800.2 pacid=42812865 polypeptide=Potri.017G001800.2.p locus=Potri.017G001800 ID=Potri.017G001800.2.v4.1 annot-version=v4.1
ATGGTTTTACTGTCTGCGTCAACGAAAGATTTATTATCGAATGCTGTTCACTTTCATCATCAAAATCGAAGCTTTTCGCCTCTCTATCACAAACCAACAC
AGCTCTCCTTTTCCTCATCATCTTCTATTGGGTTTGGGACGACTAGCATTGGCTTTGAGAGGAAAGAGCGGTCGTCCATTGTGGAAACAGCAGCTGTTAG
GCATTTGGAAGGCTCAGTTACCAAAACTGAGGGGTTTCGCTTTGCACTCGTCGTGGCTAGGTTCAATGAGATTATTACCAGGCCACTTTTAGAAGGAGCT
GTTGCAACTTTCAAGAAATATTCAGTCAAAGAAGAAGACATTGATGTTGTGTGGGTTCCTGGTAGTTTTGAAATAGGCATTGTTGCAGAAAGGTTAGGCA
AGTCAGGAAAATATCATGCAGTGGTGTGTATTGGAGCTGTGGTAAGAGGTGACACCACTCACTATGATGCTGTTGCTAATTCAGCAGCATCTGGTGTGCT
TTCTGCTGGTTTAAATTCAGGGGTTCCATGTATATTTGGTGTTCTGACATGCGAGGACATGGAACAGGCGATAAATCGAGCTGGTGGCAAATCTGGGAAT
AAGGGTGCTGAGGCTGCTTTGACAGCTATTGAGATGGCATCCTTGTTTGAGCACCATCTAAAGTAA
AA sequence
>Potri.017G001800.2 pacid=42812865 polypeptide=Potri.017G001800.2.p locus=Potri.017G001800 ID=Potri.017G001800.2.v4.1 annot-version=v4.1
MVLLSASTKDLLSNAVHFHHQNRSFSPLYHKPTQLSFSSSSSIGFGTTSIGFERKERSSIVETAAVRHLEGSVTKTEGFRFALVVARFNEIITRPLLEGA
VATFKKYSVKEEDIDVVWVPGSFEIGIVAERLGKSGKYHAVVCIGAVVRGDTTHYDAVANSAASGVLSAGLNSGVPCIFGVLTCEDMEQAINRAGGKSGN
KGAEAALTAIEMASLFEHHLK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G44050 COS1 coronatine insensitive1 suppre... Potri.017G001800 0 1 Pt-COS1.2
AT5G40810 Cytochrome C1 family (.1.2) Potri.009G165000 2.23 0.8452
AT2G29530 TIM10 Tim10/DDP family zinc finger p... Potri.009G039600 2.44 0.8163 TIM10.1
AT2G18110 Translation elongation factor... Potri.012G096400 3.16 0.8208 Pt-EEF1.2
AT4G29480 Mitochondrial ATP synthase sub... Potri.006G231900 5.65 0.8089
AT3G26340 N-terminal nucleophile aminohy... Potri.008G177000 6.00 0.8263 Pt-PBE1.2
AT3G20390 endoribonuclease L-PSP family ... Potri.001G435700 9.94 0.8000
AT1G17880 ATBTF3 basic transcription factor 3 (... Potri.015G029800 10.09 0.8377
AT5G35530 Ribosomal protein S3 family pr... Potri.018G049100 11.31 0.8421
AT3G13674 unknown protein Potri.018G082800 19.05 0.7918
AT5G24840 tRNA (guanine-N-7) methyltrans... Potri.006G277100 23.95 0.7777

Potri.017G001800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.