Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G48380 180 / 5e-54 BIR1 BAK1-interacting receptor-like kinase 1 (.1) AT3G28450 145 / 5e-41 Leucine-rich repeat protein kinase family protein (.1) AT1G69990 127 / 1e-34 Leucine-rich repeat protein kinase family protein (.1) AT1G27190 115 / 1e-30 Leucine-rich repeat protein kinase family protein (.1) AT3G49750 91 / 2e-22 AtRLP44 receptor like protein 44 (.1) AT4G20140 84 / 3e-19 GSO1 GASSHO1, Leucine-rich repeat transmembrane protein kinase (.1) AT3G56100 84 / 4e-19 IMK3, MRLK meristematic receptor-like kinase (.1) AT2G01210 82 / 2e-18 Leucine-rich repeat protein kinase family protein (.1) AT5G65830 80 / 2e-18 ATRLP57 receptor like protein 57 (.1) AT5G46330 80 / 6e-18 FLS2 FLAGELLIN-SENSITIVE 2, Leucine-rich receptor-like protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G003800 [exp] 258 / 3e-84 AT5G48380 455 / 1e-153 BAK1-interacting receptor-like kinase 1 (.1) Potri.017G004216 [exp] 244 / 2e-78 AT5G48380 412 / 2e-136 BAK1-interacting receptor-like kinase 1 (.1) Potri.008G078900 [exp] 241 / 4e-77 AT5G48380 734 / 0.0 BAK1-interacting receptor-like kinase 1 (.1) Potri.010G177900 [exp] 237 / 1e-75 AT5G48380 731 / 0.0 BAK1-interacting receptor-like kinase 1 (.1) Potri.010G178050 [exp] 224 / 8e-71 AT5G48380 710 / 0.0 BAK1-interacting receptor-like kinase 1 (.1) Potri.002G240000 [exp] 202 / 2e-62 AT5G48380 721 / 0.0 BAK1-interacting receptor-like kinase 1 (.1) Potri.017G138600 [exp] 151 / 2e-43 AT1G27190 712 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.004G081700 [exp] 148 / 3e-42 AT1G27190 747 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.017G074400 [exp] 144 / 7e-41 AT3G28450 761 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008743 [exp] 214 / 4e-67 AT5G48380 764 / 0.0 BAK1-interacting receptor-like kinase 1 (.1) Lus10036697 [exp] 203 / 2e-66 AT5G48380 215 / 8e-66 BAK1-interacting receptor-like kinase 1 (.1) Lus10037226 [exp] 195 / 3e-63 AT5G48380 221 / 6e-68 BAK1-interacting receptor-like kinase 1 (.1) Lus10002147 [exp] 195 / 2e-59 AT5G48380 755 / 0.0 BAK1-interacting receptor-like kinase 1 (.1) Lus10034278 [exp] 159 / 2e-48 AT5G48380 189 / 5e-55 BAK1-interacting receptor-like kinase 1 (.1) Lus10030811 [exp] 134 / 6e-37 AT1G27190 772 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10036704 [exp] 119 / 3e-35 AT5G48380 124 / 4e-34 BAK1-interacting receptor-like kinase 1 (.1) Lus10030812 [exp] 123 / 4e-35 AT3G28450 252 / 6e-80 Leucine-rich repeat protein kinase family protein (.1) Lus10011561 [exp] 92 / 4e-23 AT3G49750 394 / 7e-140 receptor like protein 44 (.1) Lus10019277 [exp] 89 / 9e-22 AT3G49750 399 / 8e-142 receptor like protein 44 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [poplar] [flax] LRR PF00560 [poplar] [flax] LRR_1 Leucine Rich Repeat
Representative CDS sequence Show only first row Show all	>Potri.017G003550.1 pacid=42813955 polypeptide=Potri.017G003550.1.p locus=Potri.017G003550 ID=Potri.017G003550.1.v4.1 annot-version=v4.1 ATGGATTTCAACAACAAAACAGAAGGTTTCATCTGTAGATTTATGGGAGTCGACTGCTGGCATCCTGATGAGAACAGAGTCTTAAACATCAGACTCTCTG ACCTGGGGCTCAAGGGCCAGTTCCCTCTTGGATTGGATAAGTGTACGAGCGTAAGTGGTTTGGACCTTTCACATAATGAGCTTCAGGGACCGATTCCAGC TGACATCTCTAAAAGGCTACCATTCATCACTAACCTTGACCTATCCTTCAACAACTTTTCTGGTGAAATCCCATCAAGTATTGCCAATTTATCTTTCTTA AACGATCTAAAACTCGACAACAACAAGCTAACAGGTCAAATTCCACCACAAATTGGCCAGCTCGATCGGATCAAGGTCTTTACTGTTACTAGCAATCGAT TATCAGGGCCAGTGCCAAATTTTATACATGCTAATATTCCACCAGACAGCTTTGCGAACAACGAAGGACTCTGTGGGAAGCCTTTGAATGGCTGCTCA
AA sequence Show only first row Show all	>Potri.017G003550.1 pacid=42813955 polypeptide=Potri.017G003550.1.p locus=Potri.017G003550 ID=Potri.017G003550.1.v4.1 annot-version=v4.1 MDFNNKTEGFICRFMGVDCWHPDENRVLNIRLSDLGLKGQFPLGLDKCTSVSGLDLSHNELQGPIPADISKRLPFITNLDLSFNNFSGEIPSSIANLSFL NDLKLDNNKLTGQIPPQIGQLDRIKVFTVTSNRLSGPVPNFIHANIPPDSFANNEGLCGKPLNGCS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G48380		BIR1	BAK1-interacting receptor-like...		Potri.017G003550 [exp]	0	1
AT5G48380		BIR1	BAK1-interacting receptor-like...		Potri.017G004216 [exp]	1.73	0.9964
AT5G48380		BIR1	BAK1-interacting receptor-like...		Potri.017G003601 [exp]	3.16	0.9961
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Potri.006G046100 [exp]	6.00	0.9955
AT5G37980			Zinc-binding dehydrogenase fam...		Potri.017G005400 [exp]	8.94	0.9947
AT1G59970			Matrixin family protein (.1)		Potri.008G027700 [exp]	11.83	0.9942	Pt-MMP.9
AT1G16260			Wall-associated kinase family ...		Potri.001G039200 [exp]	12.84	0.9920
AT1G16260			Wall-associated kinase family ...		Potri.001G038525 [exp]	14.49	0.9912
AT1G16260			Wall-associated kinase family ...		Potri.001G038300 [exp]	15.16	0.9898
AT1G59970			Matrixin family protein (.1)		Potri.008G027975 [exp]	15.81	0.9938
AT2G32210			unknown protein		Potri.015G120800 [exp]	18.38	0.9924

Compare expression of checked genes

Potri.017G003550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.