Potri.017G004032 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G16970 158 / 5e-48 AT-AER alkenal reductase (.1)
AT5G16990 156 / 2e-47 Zinc-binding dehydrogenase family protein (.1)
AT5G17000 155 / 6e-47 Zinc-binding dehydrogenase family protein (.1)
AT3G03080 152 / 1e-45 Zinc-binding dehydrogenase family protein (.1)
AT5G16960 142 / 7e-42 Zinc-binding dehydrogenase family protein (.1)
AT1G26320 142 / 1e-41 Zinc-binding dehydrogenase family protein (.1.2)
AT5G37940 139 / 1e-40 Zinc-binding dehydrogenase family protein (.1)
AT5G37980 138 / 3e-40 Zinc-binding dehydrogenase family protein (.1)
AT5G38000 135 / 6e-39 Zinc-binding dehydrogenase family protein (.1)
AT3G59845 122 / 7e-34 Zinc-binding dehydrogenase family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G002950 290 / 1e-99 AT5G16970 464 / 7e-165 alkenal reductase (.1)
Potri.017G002500 218 / 3e-71 AT3G03080 433 / 1e-152 Zinc-binding dehydrogenase family protein (.1)
Potri.017G006000 164 / 6e-50 AT5G37980 493 / 2e-176 Zinc-binding dehydrogenase family protein (.1)
Potri.017G002700 162 / 2e-49 AT1G26320 490 / 4e-175 Zinc-binding dehydrogenase family protein (.1.2)
Potri.007G143600 162 / 2e-49 AT5G16970 501 / 1e-179 alkenal reductase (.1)
Potri.017G005400 162 / 4e-49 AT5G37980 488 / 3e-174 Zinc-binding dehydrogenase family protein (.1)
Potri.017G004800 159 / 8e-49 AT5G16970 409 / 8e-144 alkenal reductase (.1)
Potri.017G005700 161 / 1e-48 AT1G26320 496 / 1e-176 Zinc-binding dehydrogenase family protein (.1.2)
Potri.017G002300 159 / 2e-48 AT1G26320 488 / 2e-174 Zinc-binding dehydrogenase family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036289 151 / 4e-45 AT5G16990 463 / 1e-164 Zinc-binding dehydrogenase family protein (.1)
Lus10004379 145 / 7e-43 AT5G17000 487 / 4e-174 Zinc-binding dehydrogenase family protein (.1)
Lus10004380 141 / 2e-41 AT5G37980 477 / 4e-170 Zinc-binding dehydrogenase family protein (.1)
Lus10040177 140 / 7e-41 AT5G37980 480 / 3e-171 Zinc-binding dehydrogenase family protein (.1)
Lus10003638 135 / 5e-40 AT3G03080 356 / 8e-124 Zinc-binding dehydrogenase family protein (.1)
Lus10010988 132 / 6e-38 AT5G16990 486 / 6e-174 Zinc-binding dehydrogenase family protein (.1)
Lus10007832 129 / 1e-36 AT5G16990 464 / 3e-165 Zinc-binding dehydrogenase family protein (.1)
Lus10010989 127 / 7e-36 AT5G16990 483 / 2e-172 Zinc-binding dehydrogenase family protein (.1)
Lus10007853 125 / 5e-35 AT5G16990 468 / 3e-166 Zinc-binding dehydrogenase family protein (.1)
Lus10040589 116 / 6e-31 AT1G65560 446 / 3e-156 Zinc-binding dehydrogenase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0296 GroES PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Representative CDS sequence
>Potri.017G004032.1 pacid=42814346 polypeptide=Potri.017G004032.1.p locus=Potri.017G004032 ID=Potri.017G004032.1.v4.1 annot-version=v4.1
ATGGAGACTGATGGTGGTGCTGGAAATGTTGTGAGAAACAAGAAGTTGATGCTCAAAGACTACATCAAAGGTTCCCCAAAAGAATCAGACCTTCATCTAA
CAACTGAAAGTATAGAATTGAAAGTACCACAAGGTTCAAATGCAGTTCTTGTGAAGGTTCTTTACCTCTCCATTGATCCTTACCAGTATATTCGATCCAC
GAAGATCGAAAAACCTGGCTACTTCTCTTCCTATTCCCCTGGTTCTGTGATGGCCAGTTATGGAGTGGGTAGAGTTCTTGAATCTGGACACTCTGATTTC
CAAAAGGGTGATCTTGTTTGGGGAACAACTGGATGGGAAGAGTACAGTCTGATTACAGAACCTGAAACTCTCTTTAAAATCCAACACTCAGATGTACCCT
TATCTTACTATTTGGGAGTTCTTGGTATGCCTGGTTGTTGTGTGGTCCCGCACCATGTGATGGGGGACCACCACATTAATTAA
AA sequence
>Potri.017G004032.1 pacid=42814346 polypeptide=Potri.017G004032.1.p locus=Potri.017G004032 ID=Potri.017G004032.1.v4.1 annot-version=v4.1
METDGGAGNVVRNKKLMLKDYIKGSPKESDLHLTTESIELKVPQGSNAVLVKVLYLSIDPYQYIRSTKIEKPGYFSSYSPGSVMASYGVGRVLESGHSDF
QKGDLVWGTTGWEEYSLITEPETLFKIQHSDVPLSYYLGVLGMPGCCVVPHHVMGDHHIN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G16970 AT-AER alkenal reductase (.1) Potri.017G004032 0 1
AT1G26320 Zinc-binding dehydrogenase fam... Potri.017G003950 2.00 0.8329
AT2G12550 NUB1 homolog of human NUB1, ubiquit... Potri.018G118143 11.40 0.7750
AT3G56970 bHLH ORG2, bHLH038 OBP3-RESPONSIVE GENE 3, basic ... Potri.016G037300 12.00 0.7641 Pt-ORG2.3
AT5G03860 MLS malate synthase (.1.2) Potri.015G092000 12.48 0.8136
AT1G44170 ALDH4, ALDH3H1 aldehyde dehydrogenase 4, alde... Potri.002G081800 14.69 0.7272 Pt-ALDH3.1
AT5G05700 ATATE1, DLS1, A... DELAYED LEAF SENESCENCE 1, arg... Potri.008G067000 22.36 0.7095 Pt-ATE1.3
AT3G62390 TBL6 TRICHOME BIREFRINGENCE-LIKE 6 ... Potri.014G120201 23.66 0.8088
AT1G60690 NAD(P)-linked oxidoreductase s... Potri.002G234000 27.71 0.7685
AT4G20350 oxidoreductases (.1.2) Potri.013G161600 32.31 0.7977
AT4G27190 NB-ARC domain-containing disea... Potri.001G420000 41.56 0.8055

Potri.017G004032 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.