Potri.017G004701 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G59850 374 / 6e-130 Pectin lyase-like superfamily protein (.1)
AT2G43870 362 / 3e-125 Pectin lyase-like superfamily protein (.1)
AT2G43860 302 / 2e-101 Pectin lyase-like superfamily protein (.1)
AT1G05660 301 / 2e-101 Pectin lyase-like superfamily protein (.1)
AT1G65570 294 / 2e-98 Pectin lyase-like superfamily protein (.1)
AT2G43890 286 / 2e-95 Pectin lyase-like superfamily protein (.1)
AT1G05650 285 / 4e-95 Pectin lyase-like superfamily protein (.1)
AT2G43880 279 / 1e-92 Pectin lyase-like superfamily protein (.1)
AT3G14040 208 / 2e-64 Pectin lyase-like superfamily protein (.1)
AT3G07850 207 / 5e-64 Pectin lyase-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G004500 479 / 3e-171 AT3G59850 520 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.017G005300 478 / 9e-171 AT3G59850 504 / 3e-179 Pectin lyase-like superfamily protein (.1)
Potri.017G003500 476 / 5e-170 AT3G59850 498 / 4e-177 Pectin lyase-like superfamily protein (.1)
Potri.017G005600 474 / 2e-169 AT3G59850 496 / 5e-176 Pectin lyase-like superfamily protein (.1)
Potri.017G005900 473 / 8e-169 AT3G59850 486 / 3e-172 Pectin lyase-like superfamily protein (.1)
Potri.007G144200 452 / 7e-161 AT3G59850 482 / 1e-170 Pectin lyase-like superfamily protein (.1)
Potri.007G144400 446 / 3e-158 AT3G59850 476 / 2e-168 Pectin lyase-like superfamily protein (.1)
Potri.017G005800 442 / 8e-157 AT3G59850 499 / 2e-177 Pectin lyase-like superfamily protein (.1)
Potri.017G006200 443 / 2e-156 AT3G59850 503 / 7e-178 Pectin lyase-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002123 409 / 1e-143 AT2G43870 498 / 5e-177 Pectin lyase-like superfamily protein (.1)
Lus10011419 408 / 3e-143 AT2G43870 507 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10002125 398 / 2e-139 AT3G59850 509 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10011418 356 / 8e-123 AT2G43870 499 / 2e-177 Pectin lyase-like superfamily protein (.1)
Lus10002124 356 / 9e-123 AT2G43870 505 / 7e-180 Pectin lyase-like superfamily protein (.1)
Lus10002126 328 / 2e-111 AT2G43870 461 / 1e-162 Pectin lyase-like superfamily protein (.1)
Lus10022530 317 / 4e-107 AT2G43870 471 / 4e-166 Pectin lyase-like superfamily protein (.1)
Lus10008343 274 / 4e-90 AT1G05650 425 / 1e-147 Pectin lyase-like superfamily protein (.1)
Lus10010584 273 / 7e-90 AT1G05660 424 / 2e-147 Pectin lyase-like superfamily protein (.1)
Lus10005304 272 / 1e-89 AT1G05660 420 / 1e-145 Pectin lyase-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Representative CDS sequence
>Potri.017G004701.1 pacid=42814456 polypeptide=Potri.017G004701.1.p locus=Potri.017G004701 ID=Potri.017G004701.1.v4.1 annot-version=v4.1
ATGTTAATGGGGTTACTGTATCTGGAGGGACTCTTGATGGCCAGGGTGCTGGACTGTGGTCTTGCAAGAATTCCGGCAAGGGTTGCCCGCCCCAGAGGCG
CAACGTCACTTGAGTTTTCCAATTCAAACAATATTGCAATTACCGGATTGGCATCATTAAATAGCCAGTTGTTTCACATTGTCATCAATGGTTGCCAAAA
CGTCAAAGTGCAAGGAGTCAAAGTCTCTGCCGCCGGAAACAGCCCTAACACGGATGGTATTCATGTTCAATCATCAACCGGTGTCACCATATTGAATTCT
AGGATTGGAACAGGTGACGACTGTGTATCGATTGGCCCCGGTACCTCAAGTTTGTGGATTGAAAGTGTGGCTTGTGGACCTGGCCATGGAATCAGCATTG
GAAGTTTAGGCAAAGAATCCCAAGAGGCTGGTGTGCAAAATGTTACAGTCATGACCACTACATTTACCGGTACAGAAAATGGACTGAGAATTAAGTCTTG
GGGAAGGCCTAGCAATCGTTTTGCTAGAGATATTCTTTTCCAACATGCAGTCATGAATAACGTCCAAAATCCCATTGTAATAGACCAAAACTATTGCCCC
GGCGAGAAGAATTGCCCTGGCCAGGTTTCTGGTGTGAAAATAAGTGATGTGACCTACCAAGACATTCATGGATCATCAGCAACAGAAGTGGCGGTCAAAT
TTGATTGTAGCAAAAAATATCCATGCACTGGGATCAAATTAGAAGATGTAAAGCTCACTTACAAGAATCAGCCAGCTGAAGCATCATGCAGCAATGCTGG
TGGAGTTGCTTCAGGACTTGTTCAGCCCACTAGCTGTCTATAA
AA sequence
>Potri.017G004701.1 pacid=42814456 polypeptide=Potri.017G004701.1.p locus=Potri.017G004701 ID=Potri.017G004701.1.v4.1 annot-version=v4.1
MLMGLLYLEGLLMARVLDCGLARIPARVARPRGATSLEFSNSNNIAITGLASLNSQLFHIVINGCQNVKVQGVKVSAAGNSPNTDGIHVQSSTGVTILNS
RIGTGDDCVSIGPGTSSLWIESVACGPGHGISIGSLGKESQEAGVQNVTVMTTTFTGTENGLRIKSWGRPSNRFARDILFQHAVMNNVQNPIVIDQNYCP
GEKNCPGQVSGVKISDVTYQDIHGSSATEVAVKFDCSKKYPCTGIKLEDVKLTYKNQPAEASCSNAGGVASGLVQPTSCL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G59850 Pectin lyase-like superfamily ... Potri.017G004701 0 1
AT3G59850 Pectin lyase-like superfamily ... Potri.017G005900 9.16 0.7039
AT3G57440 unknown protein Potri.006G050900 15.93 0.7311
Potri.004G152750 27.92 0.5463
AT3G57790 Pectin lyase-like superfamily ... Potri.006G057100 39.30 0.5888
AT1G74830 Protein of unknown function, D... Potri.015G068400 44.04 0.5937
Potri.005G031948 47.37 0.6979
AT5G05800 unknown protein Potri.010G045701 49.30 0.6979
AT4G11850 PLDGAMMA1, MEE5... maternal effect embryo arrest ... Potri.004G218900 50.05 0.6960
Potri.014G110850 51.16 0.5716
Potri.002G132850 54.84 0.6935

Potri.017G004701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.