Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G45860 67 / 9e-15 CRK4 cysteine-rich RLK (RECEPTOR-like protein kinase) 4 (.1) AT4G11480 67 / 1e-14 CRK32 cysteine-rich RLK (RECEPTOR-like protein kinase) 32 (.1) AT4G23280 67 / 1e-14 CRK20 cysteine-rich RLK (RECEPTOR-like protein kinase) 20 (.1) AT1G27190 66 / 4e-14 Leucine-rich repeat protein kinase family protein (.1) AT4G11470 65 / 4e-14 CRK31 cysteine-rich RLK (RECEPTOR-like protein kinase) 31 (.1) AT4G23130 65 / 7e-14 RLK6, CRK5 RECEPTOR-LIKE PROTEIN KINASE 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.2) AT4G23180 64 / 1e-13 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) AT4G21410 64 / 2e-13 CRK29 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) AT4G23230 64 / 2e-13 CRK15 cysteine-rich RLK (RECEPTOR-like protein kinase) 15 (.1) AT1G69990 62 / 5e-13 Leucine-rich repeat protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G003400 [exp] 140 / 5e-42 AT5G48380 209 / 1e-61 BAK1-interacting receptor-like kinase 1 (.1) Potri.017G005150 [exp] 134 / 2e-39 AT5G48380 213 / 6e-63 BAK1-interacting receptor-like kinase 1 (.1) Potri.017G004400 [exp] 134 / 2e-39 AT5G48380 221 / 1e-65 BAK1-interacting receptor-like kinase 1 (.1) Potri.017G007600 [exp] 100 / 9e-27 AT5G48380 208 / 5e-61 BAK1-interacting receptor-like kinase 1 (.1) Potri.017G003800 [exp] 88 / 5e-22 AT5G48380 455 / 1e-153 BAK1-interacting receptor-like kinase 1 (.1) Potri.017G004216 [exp] 87 / 7e-22 AT5G48380 412 / 2e-136 BAK1-interacting receptor-like kinase 1 (.1) Potri.007G144000 [exp] 83 / 9e-22 AT5G48380 162 / 4e-47 BAK1-interacting receptor-like kinase 1 (.1) Potri.017G003601 [exp] 86 / 1e-21 AT5G48380 255 / 3e-80 BAK1-interacting receptor-like kinase 1 (.1) Potri.008G078900 [exp] 77 / 4e-18 AT5G48380 734 / 0.0 BAK1-interacting receptor-like kinase 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034279 [exp] 77 / 1e-18 AT5G48380 213 / 1e-64 BAK1-interacting receptor-like kinase 1 (.1) Lus10030811 [exp] 67 / 2e-14 AT1G27190 772 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10031592 [exp] 66 / 2e-14 AT4G03230 351 / 3e-107 S-locus lectin protein kinase family protein (.1) Lus10008743 [exp] 66 / 3e-14 AT5G48380 764 / 0.0 BAK1-interacting receptor-like kinase 1 (.1) Lus10002147 [exp] 66 / 5e-14 AT5G48380 755 / 0.0 BAK1-interacting receptor-like kinase 1 (.1) Lus10018512 [exp] 65 / 5e-14 AT4G03230 823 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10039725 [exp] 65 / 6e-14 AT4G03230 445 / 5e-144 S-locus lectin protein kinase family protein (.1) Lus10018402 [exp] 65 / 7e-14 AT1G11340 691 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10031591 [exp] 65 / 8e-14 AT4G03230 853 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10012159 [exp] 64 / 1e-13 AT5G49760 1058 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.017G005500.2 pacid=42812829 polypeptide=Potri.017G005500.2.p locus=Potri.017G005500 ID=Potri.017G005500.2.v4.1 annot-version=v4.1 ATGGGGACAACGTATAGGGCAGCGCACCCTTATGATTGTTTCACTGCAGTTAAGAGGTTACATGACTCTCAACCTTTAGGGAAACAGTTCAGGTCTGAGC TAATCATTCTAGCCAAGTTCAGACACATGAACATAATTCCACTACTAGGATTCTGCATAGAATCCGGGGAGAGGCTTTTGGTGTATAAATATATACCAAA TGAAACCTTCATGATTGATTATGTTAGAGAATAA
AA sequence Show only first row Show all	>Potri.017G005500.2 pacid=42812829 polypeptide=Potri.017G005500.2.p locus=Potri.017G005500 ID=Potri.017G005500.2.v4.1 annot-version=v4.1 MGTTYRAAHPYDCFTAVKRLHDSQPLGKQFRSELIILAKFRHMNIIPLLGFCIESGERLLVYKYIPNETFMIDYVRE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G11480		CRK32	cysteine-rich RLK (RECEPTOR-li...		Potri.017G005500 [exp]	0	1
AT1G21550			Calcium-binding EF-hand family...		Potri.002G077300 [exp]	3.74	0.9938
AT5G48380		BIR1	BAK1-interacting receptor-like...		Potri.017G003251 [exp]	6.24	0.9910
AT5G48380		BIR1	BAK1-interacting receptor-like...		Potri.017G003800 [exp]	8.83	0.9889
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Potri.006G046100 [exp]	10.77	0.9910
AT5G48380		BIR1	BAK1-interacting receptor-like...		Potri.017G004216 [exp]	13.03	0.9893
AT5G48380		BIR1	BAK1-interacting receptor-like...		Potri.017G003601 [exp]	14.49	0.9886
AT5G48380		BIR1	BAK1-interacting receptor-like...		Potri.017G004400 [exp]	17.74	0.9881
					Potri.017G003866 [exp]	20.49	0.9854
AT1G59970			Matrixin family protein (.1)		Potri.008G027700 [exp]	21.90	0.9878	Pt-MMP.9
AT4G39830			Cupredoxin superfamily protein...		Potri.005G079400 [exp]	22.58	0.9814	Pt-AO1.3

Compare expression of checked genes

Potri.017G005500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.