Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18250 195 / 7e-58 receptor serine/threonine kinase, putative (.1) AT1G66980 196 / 1e-57 GDPDL2, SNC4 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1) AT5G38260 192 / 1e-57 Protein kinase superfamily protein (.1) AT1G67000 193 / 4e-57 Protein kinase superfamily protein (.1) AT1G70250 190 / 3e-56 receptor serine/threonine kinase, putative (.1) AT1G66930 188 / 5e-56 Protein kinase superfamily protein (.1) AT5G39020 188 / 2e-55 Malectin/receptor-like protein kinase family protein (.1) AT1G66920 183 / 2e-54 Protein kinase superfamily protein (.1.2) AT5G38280 182 / 6e-54 PR5K PR5-like receptor kinase (.1) AT1G66910 181 / 1e-53 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G009000 [exp] 375 / 3e-132 AT5G38280 306 / 3e-99 PR5-like receptor kinase (.1) Potri.017G008600 [exp] 360 / 2e-122 AT5G38260 325 / 9e-103 Protein kinase superfamily protein (.1) Potri.017G008800 [exp] 357 / 2e-120 AT5G38280 330 / 1e-103 PR5-like receptor kinase (.1) Potri.017G009400 [exp] 347 / 1e-116 AT5G38280 329 / 4e-103 PR5-like receptor kinase (.1) Potri.017G009100 [exp] 346 / 3e-116 AT5G38280 331 / 1e-103 PR5-like receptor kinase (.1) Potri.017G007900 [exp] 341 / 2e-114 AT5G38260 324 / 1e-101 Protein kinase superfamily protein (.1) Potri.017G009600 [exp] 333 / 4e-111 AT4G18250 323 / 1e-98 receptor serine/threonine kinase, putative (.1) Potri.015G122000 [exp] 321 / 2e-110 AT5G38280 336 / 2e-110 PR5-like receptor kinase (.1) Potri.007G141125 [exp] 325 / 1e-107 AT5G38280 335 / 9e-105 PR5-like receptor kinase (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027006 [exp] 254 / 1e-83 AT1G66980 218 / 1e-66 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1) Lus10025492 [exp] 259 / 5e-83 AT5G38260 326 / 1e-102 Protein kinase superfamily protein (.1) Lus10022359 [exp] 254 / 7e-82 AT1G66980 322 / 3e-101 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1) Lus10027085 [exp] 241 / 2e-80 AT1G66980 275 / 1e-84 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1) Lus10025545 [exp] 241 / 1e-79 AT5G39020 316 / 1e-101 Malectin/receptor-like protein kinase family protein (.1) Lus10027116 [exp] 238 / 1e-79 AT5G39030 209 / 2e-63 Protein kinase superfamily protein (.1) Lus10008335 [exp] 247 / 1e-77 AT1G70250 316 / 8e-98 receptor serine/threonine kinase, putative (.1) Lus10027119 [exp] 236 / 3e-75 AT5G38260 210 / 3e-60 Protein kinase superfamily protein (.1) Lus10014924 [exp] 234 / 2e-73 AT1G67000 349 / 5e-112 Protein kinase superfamily protein (.1) Lus10008362 [exp] 229 / 8e-73 AT1G66930 250 / 7e-75 Protein kinase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF00069 [poplar] [flax] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Potri.017G008100.2 pacid=42813663 polypeptide=Potri.017G008100.2.p locus=Potri.017G008100 ID=Potri.017G008100.2.v4.1 annot-version=v4.1 ATGGACAAGATTTTATCAACGAAGTTGCCACAATTGGAAGAATTCACCATGTCAAATGTCGTGCAACTTATAGGCTACACTGTCGAGGGATCGAAGCATG CTCTTATATACGAGTTCATGCCTAATGGGTCTCTTGAAAAGTACATTTTTTCTAGGGAAGGTAGCGTCCCACTAAGCAATGAGAAAATGTATGAGATTTC TCTTGGGGTGGCTCATGGCATTCAATATCTACATCAAGGTTGTGATATGCAAATCTTACATTTTGATATCAAACCTCACAACATTCTTCTTAATGATAAG TTTGTTCCGAAAGTTTCAGATTTTGGACTAGCCAAATTGTACCCAACAAATAATAACATTGTGTCCCTCACTGCTGCCAGAGGGACAATGGGATATATGG CTCCTGAACTATGTTATAAGAATATTGGAGGTGTCTCTTTCAAAGCTGATGTCTATAGTTACGGGATGTTATTGATGGAAATGGTAGGAAGAAGAAAGAA CTTGAATGCATTGGCAAATCATTCAAGCCAAATTTACTTCCCATCATGGGTTTATGACCAAGTTAGTGAAGGAAAGAATATAGAAGTACAAGAAGAGCCT TGGAACATGGAAAGAAAACAACGAAAAAGATGA
AA sequence Show only first row Show all	>Potri.017G008100.2 pacid=42813663 polypeptide=Potri.017G008100.2.p locus=Potri.017G008100 ID=Potri.017G008100.2.v4.1 annot-version=v4.1 MDKILSTKLPQLEEFTMSNVVQLIGYTVEGSKHALIYEFMPNGSLEKYIFSREGSVPLSNEKMYEISLGVAHGIQYLHQGCDMQILHFDIKPHNILLNDK FVPKVSDFGLAKLYPTNNNIVSLTAARGTMGYMAPELCYKNIGGVSFKADVYSYGMLLMEMVGRRKNLNALANHSSQIYFPSWVYDQVSEGKNIEVQEEP WNMERKQRKR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G18250			receptor serine/threonine kina...		Potri.017G008100 [exp]	0	1
AT5G38280		PR5K	PR5-like receptor kinase (.1)		Potri.017G009000 [exp]	1.00	0.9864
AT5G38260			Protein kinase superfamily pro...		Potri.017G008600 [exp]	3.00	0.9774
AT3G16370			GDSL-like Lipase/Acylhydrolase...		Potri.001G191600 [exp]	14.14	0.9676
AT5G46880	HD	HDG5, HB-7	HOMEODOMAIN GLABROUS 5, homeob...		Potri.001G137800 [exp]	14.83	0.9739
AT3G16370			GDSL-like Lipase/Acylhydrolase...		Potri.006G144400 [exp]	21.02	0.9602
AT5G63160		BT1	BTB and TAZ domain protein 1 (...		Potri.015G087700 [exp]	21.35	0.9588
AT3G16660			Pollen Ole e 1 allergen and ex...		Potri.010G012400 [exp]	24.97	0.9632
AT4G29990			Leucine-rich repeat transmembr...		Potri.019G094300 [exp]	26.15	0.9543
					Potri.018G115601 [exp]	26.19	0.9611
					Potri.001G284032 [exp]	26.26	0.9610

Compare expression of checked genes

Potri.017G008100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.