Potri.017G009000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G38280 306 / 3e-99 PR5K PR5-like receptor kinase (.1)
AT1G70250 308 / 1e-98 receptor serine/threonine kinase, putative (.1)
AT1G66980 314 / 2e-98 GDPDL2, SNC4 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1)
AT4G18250 307 / 1e-97 receptor serine/threonine kinase, putative (.1)
AT5G38260 297 / 6e-96 Protein kinase superfamily protein (.1)
AT5G39020 298 / 2e-94 Malectin/receptor-like protein kinase family protein (.1)
AT1G67000 297 / 1e-93 Protein kinase superfamily protein (.1)
AT1G66910 291 / 2e-93 Protein kinase superfamily protein (.1)
AT1G66930 290 / 9e-93 Protein kinase superfamily protein (.1)
AT1G66920 288 / 2e-92 Protein kinase superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G008800 626 / 0 AT5G38280 330 / 1e-103 PR5-like receptor kinase (.1)
Potri.017G009100 619 / 0 AT5G38280 331 / 1e-103 PR5-like receptor kinase (.1)
Potri.017G009400 618 / 0 AT5G38280 329 / 4e-103 PR5-like receptor kinase (.1)
Potri.017G007900 593 / 0 AT5G38260 324 / 1e-101 Protein kinase superfamily protein (.1)
Potri.017G008600 587 / 0 AT5G38260 325 / 9e-103 Protein kinase superfamily protein (.1)
Potri.017G009600 583 / 0 AT4G18250 323 / 1e-98 receptor serine/threonine kinase, putative (.1)
Potri.017G009500 568 / 0 AT5G38280 327 / 3e-102 PR5-like receptor kinase (.1)
Potri.015G122000 548 / 0 AT5G38280 336 / 2e-110 PR5-like receptor kinase (.1)
Potri.007G117050 532 / 0 AT5G38280 338 / 5e-106 PR5-like receptor kinase (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022359 405 / 1e-138 AT1G66980 322 / 3e-101 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1)
Lus10025492 406 / 6e-138 AT5G38260 326 / 1e-102 Protein kinase superfamily protein (.1)
Lus10025545 388 / 2e-135 AT5G39020 316 / 1e-101 Malectin/receptor-like protein kinase family protein (.1)
Lus10008335 400 / 7e-135 AT1G70250 316 / 8e-98 receptor serine/threonine kinase, putative (.1)
Lus10014924 394 / 1e-133 AT1G67000 349 / 5e-112 Protein kinase superfamily protein (.1)
Lus10027085 323 / 2e-110 AT1G66980 275 / 1e-84 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1)
Lus10008362 319 / 9e-106 AT1G66930 250 / 7e-75 Protein kinase superfamily protein (.1)
Lus10027006 309 / 3e-103 AT1G66980 218 / 1e-66 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1)
Lus10025547 312 / 3e-102 AT1G66920 345 / 2e-111 Protein kinase superfamily protein (.1.2)
Lus10025553 313 / 8e-102 AT1G70250 341 / 4e-108 receptor serine/threonine kinase, putative (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF00069 Pkinase Protein kinase domain
Representative CDS sequence
>Potri.017G009000.1 pacid=42814516 polypeptide=Potri.017G009000.1.p locus=Potri.017G009000 ID=Potri.017G009000.1.v4.1 annot-version=v4.1
ATGCCGATAAAGTACACTTACTTAGAGATTAAGAAAATAACCAACGGATTTAAAGACAAGTTGGGTGAAGGAAGCTTTGGCTCAGTGTATAAGGGGAAGC
TTCGTAGTGGTCGTTTTGCAGCAGTAAAATTATTTGGCAAGTCAAAAGCCAATGGACAAGATTTTATCAACGAAGTTGCCACAATTGGAAGAATTCACCA
TGTCAATGTCGTGCAACTTATAGGCTACACTGTCGAGGGATCGAAGCATGCTTTTATATACGAGTTCATGCCTAATGGGTCTCTTGAAAAGTACATTTTT
TCTAGGGAAGGTAGCGTCCCACTAAGCAATGAGAAAATGTATGAGATTTCTCTTGGGGTGGCTCATGGCATTCAATATCTACATCAAGGTTGTGATATGC
AAATCTTACATTTTGATATCAAACCTCACAACATTCTTCTTAATGATAAGTTTGTTCCGAAAGTTTCAGATTTTGGACTAGCCAAATTGTACCCAACAAA
TAATAACATTGTGTCCCTCACTGCTGCCAGAGGGACAATGGGATATATGGCTCCTGAACTATGTTATAAGAATATTGGAGATGTCTCTTTCAAAGCTGAT
GTCTATAGTTACGGGATGTTATTGATGGAAATGGTAGGAAGAAGAAAGAACTTGAATGCATTGGCAAATCATTCAAGCCAAATTTACTTCCCATCATGGG
TTTATGACCAAGTTAGTGAAGGAAAGGATATAGAAGTACAAGAAGATGCCTTGGAACATGGAAAGAAAACAACGAAAAAGATGATTATTGTGGCATTATG
TTGCATACAGTTGAAGCATGTTGATCGTCCCTCTATGCATAAAGTTGTAGAGATGCTTGAATCGGATGTTGAATCCCTACGAATGCCTCCTAAACCTTTT
CTCACCCCACATCAGATTCTAGAAGATGATGATAGAACTAATCATGCAAAATTATCAGATCCACTAAATGATTGTATTTACTCTTCATATCAGTTTGGTC
GTTAA
AA sequence
>Potri.017G009000.1 pacid=42814516 polypeptide=Potri.017G009000.1.p locus=Potri.017G009000 ID=Potri.017G009000.1.v4.1 annot-version=v4.1
MPIKYTYLEIKKITNGFKDKLGEGSFGSVYKGKLRSGRFAAVKLFGKSKANGQDFINEVATIGRIHHVNVVQLIGYTVEGSKHAFIYEFMPNGSLEKYIF
SREGSVPLSNEKMYEISLGVAHGIQYLHQGCDMQILHFDIKPHNILLNDKFVPKVSDFGLAKLYPTNNNIVSLTAARGTMGYMAPELCYKNIGDVSFKAD
VYSYGMLLMEMVGRRKNLNALANHSSQIYFPSWVYDQVSEGKDIEVQEDALEHGKKTTKKMIIVALCCIQLKHVDRPSMHKVVEMLESDVESLRMPPKPF
LTPHQILEDDDRTNHAKLSDPLNDCIYSSYQFGR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G38280 PR5K PR5-like receptor kinase (.1) Potri.017G009000 0 1
AT4G18250 receptor serine/threonine kina... Potri.017G008100 1.00 0.9864
AT5G38260 Protein kinase superfamily pro... Potri.017G008600 2.44 0.9793
AT3G01390 AVMA10, VMA10 vacuolar membrane ATPase 10 (.... Potri.013G108300 4.89 0.9697
AT4G01950 ATGPAT3, GPAT3 glycerol-3-phosphate acyltrans... Potri.002G192600 9.79 0.9748
AT5G60740 ABCG28 ATP-binding cassette G28, ABC ... Potri.001G058900 10.95 0.9667
AT3G16370 GDSL-like Lipase/Acylhydrolase... Potri.001G191600 11.22 0.9741
AT3G21090 ABCG15 ATP-binding cassette G15, ABC-... Potri.016G056700 11.61 0.9540
AT2G01340 At17.1 unknown protein Potri.004G088200 12.72 0.9661
AT4G31980 unknown protein Potri.003G206201 14.42 0.9691
AT4G20970 bHLH bHLH162 basic helix-loop-helix (bHLH) ... Potri.004G044400 14.49 0.9578

Potri.017G009000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.