Plant FIBer expression Database

Potri.017G015134 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G142920
[exp]
77 / 3e-17 ND /
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.017G015134.1 pacid=42813969 polypeptide=Potri.017G015134.1.p locus=Potri.017G015134 ID=Potri.017G015134.1.v4.1 annot-version=v4.1
ATGTGCACGAGGTGCACGCTTCGGCAGGCTGGCCAAAACAAGGCCGAAGGGTGCTGGCAGCCATGCCATCAGTGGGAGAAATCGTCAGCGCAGATTTATG
CGGCTGTAGGTTCGTCAAAGGGAAAATCGGCAGCGCAGATTGTTGACGAACATGGGCTGGACGAGGGACTGTCCAAGCCTCGTCAGGAGGATAGGCTGAC
GAGAATTGGGACTATCGCAGAATTCGGCAGCGTAGACAGGGGCAGCCTGCACGCAGATGCGAATTCGGCAGCGCAGAGATTGGCAGCACGCATATGCGAA
TTCGGCAGCGCATTGGCAGCTTGCCTGCAGATGCGGACTCGGCAGCGCGCAGCAAACTTGTGCAAGTCAGGGGCTCGACTTGGCACGATCTAA
AA sequence
>Potri.017G015134.1 pacid=42813969 polypeptide=Potri.017G015134.1.p locus=Potri.017G015134 ID=Potri.017G015134.1.v4.1 annot-version=v4.1
MCTRCTLRQAGQNKAEGCWQPCHQWEKSSAQIYAAVGSSKGKSAAQIVDEHGLDEGLSKPRQEDRLTRIGTIAEFGSVDRGSLHADANSAAQRLAARICE
FGSALAACLQMRTRQRAANLCKSGARLGTI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.017G015134
[exp]
0 1
Potri.014G055150
[exp]
1.73 0.8821
AT5G54680 bHLH bHLH105, ILR3 iaa-leucine resistant3, basic ... Potri.011G132400
[exp]
4.89 0.8134
AT3G02340 RING/U-box superfamily protein... Potri.001G185200
[exp]
25.69 0.7854
AT3G27100 unknown protein Potri.017G069200
[exp]
26.32 0.7767
ATCG00540 ATCG00540.1, PE... photosynthetic electron transf... Potri.013G162200
[exp]
33.04 0.7563
AT1G76060 EMB1793 EMBRYO DEFECTIVE 1793, LYR fam... Potri.002G016600
[exp]
37.46 0.7530 Pt-EMB1793.1
AT1G49950 MYB ATTRB1, TRB1 telomere repeat binding factor... Potri.009G087000
[exp]
39.33 0.7696 SMH901
AT3G09780 CCR1, ATCRR1 CRINKLY4 related 1 (.1) Potri.006G128350
[exp]
42.89 0.7887
Potri.003G153400
[exp]
66.35 0.7608
AT3G16210 F-box family protein (.1) Potri.012G099733
[exp]
66.97 0.7234

Potri.017G015134 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.