Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PtrGrx3
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G28480 132 / 2e-40 roxy19, GRX480 Thioredoxin superfamily protein (.1) AT1G03850 110 / 2e-31 ATGRXS13 glutaredoxin 13, Glutaredoxin family protein (.1.2) AT4G15700 91 / 2e-24 Thioredoxin superfamily protein (.1) AT4G15690 91 / 2e-24 Thioredoxin superfamily protein (.1) AT5G18600 87 / 6e-23 Thioredoxin superfamily protein (.1) AT5G14070 88 / 1e-22 ROXY2 Thioredoxin superfamily protein (.1) AT4G15670 86 / 3e-22 Thioredoxin superfamily protein (.1) AT4G15660 85 / 3e-22 Thioredoxin superfamily protein (.1) AT4G15680 85 / 4e-22 Thioredoxin superfamily protein (.1) AT3G02000 81 / 3e-20 ROXY1 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G134800 [exp] 250 / 1e-86 AT1G28480 141 / 9e-44 Thioredoxin superfamily protein (.1) Potri.004G049800 [exp] 138 / 2e-42 AT1G28480 94 / 2e-25 Thioredoxin superfamily protein (.1) Potri.011G058800 [exp] 134 / 5e-41 AT1G28480 102 / 2e-28 Thioredoxin superfamily protein (.1) Potri.001G325800 [exp] 100 / 9e-28 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1) Potri.001G060600 [exp] 97 / 2e-26 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1) Potri.003G167000 [exp] 97 / 2e-26 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1) Potri.010G021800 [exp] 81 / 3e-20 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1) Potri.008G214500 [exp] 81 / 3e-20 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1) Potri.014G133900 [exp] 77 / 8e-19 AT3G62930 141 / 4e-45 Thioredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018631 [exp] 157 / 3e-50 AT1G28480 127 / 8e-39 Thioredoxin superfamily protein (.1) Lus10039867 [exp] 155 / 3e-49 AT1G28480 127 / 7e-39 Thioredoxin superfamily protein (.1) Lus10013962 [exp] 132 / 2e-40 AT1G28480 135 / 3e-42 Thioredoxin superfamily protein (.1) Lus10041538 [exp] 110 / 2e-31 AT5G14070 134 / 3e-41 Thioredoxin superfamily protein (.1) Lus10038514 [exp] 100 / 2e-27 AT5G14070 122 / 2e-36 Thioredoxin superfamily protein (.1) Lus10017693 [exp] 97 / 5e-27 AT1G28480 100 / 4e-29 Thioredoxin superfamily protein (.1) Lus10033649 [exp] 97 / 7e-27 AT1G28480 100 / 5e-29 Thioredoxin superfamily protein (.1) Lus10035183 [exp] 97 / 4e-26 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1) Lus10023295 [exp] 94 / 5e-25 AT5G14070 123 / 5e-37 Thioredoxin superfamily protein (.1) Lus10011333 [exp] 90 / 3e-23 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00462 [poplar] [flax] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Potri.017G017300.1 pacid=42813505 polypeptide=Potri.017G017300.1.p locus=Potri.017G017300 ID=Potri.017G017300.1.v4.1 annot-version=v4.1 ATGCAGCAGGCAATACCTTACAAGTCATGGCTACCCTTATACACCAACAACAAGCCTCTCATAAGCCCTTCACAACTTATTAGCCACCATAGCAATGGGG GAGTGGTTGCAGCTCAAGAAGTGCTCAAAGGGTCAAGAAATATAAGCGAGATGGTACAAGAGAATGCAATCATAGTGTTTGCTAGACGTGGATGCTGCAT GAGCCATGTTGCGAAACGTTTGCTTTTAGGGCTTGGTGTGAATCCAGCTGTTTATGAGATTGATGAGGCTGATGAGATTAGTGTTTTAGAAGAACTGGAA ATGATTGGTAATGATATTGGTGGAAAGGGGAATAATAAGAAGAAAGTTCAGTTTCCTGCTCTTGTCATCGGTGGAAAGTTGTTTGGTGGATTGGATACAC TTATGGCTACTCATATTTCAGGAGAATTGGTTCCTATTTTGAAAGAAGCTGGAGCCTTATGGCTTTGA
AA sequence Show only first row Show all	>Potri.017G017300.1 pacid=42813505 polypeptide=Potri.017G017300.1.p locus=Potri.017G017300 ID=Potri.017G017300.1.v4.1 annot-version=v4.1 MQQAIPYKSWLPLYTNNKPLISPSQLISHHSNGGVVAAQEVLKGSRNISEMVQENAIIVFARRGCCMSHVAKRLLLGLGVNPAVYEIDEADEISVLEELE MIGNDIGGKGNNKKKVQFPALVIGGKLFGGLDTLMATHISGELVPILKEAGALWL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G28480		roxy19, GRX480	Thioredoxin superfamily protei...		Potri.017G017300 [exp]	0	1	PtrGrx3
AT1G70530		CRK3	cysteine-rich RLK (RECEPTOR-li...		Potri.010G043900 [exp]	2.00	0.9112
AT5G25930			Protein kinase family protein ...		Potri.006G235800 [exp]	2.82	0.9017
AT5G25930			Protein kinase family protein ...		Potri.006G235500 [exp]	4.24	0.8974
AT2G22860		ATPSK2	phytosulfokine 2 precursor (.1...		Potri.002G116300 [exp]	5.47	0.8901
AT3G48520		CYP94B3	cytochrome P450, family 94, su...		Potri.005G220700 [exp]	7.34	0.8898	Pt-CYP94.7
AT4G04720		CPK21	calcium-dependent protein kina...		Potri.011G003400 [exp]	7.93	0.8780
AT5G25930			Protein kinase family protein ...		Potri.006G235450 [exp]	8.66	0.8678
AT2G32300		UCC1	uclacyanin 1 (.1)		Potri.018G129200 [exp]	12.48	0.8950
AT5G42440			Protein kinase superfamily pro...		Potri.002G065400 [exp]	14.42	0.8833
AT5G05300			unknown protein		Potri.013G083500 [exp]	14.69	0.8723

Compare expression of checked genes

Potri.017G017300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.