Potri.017G020266 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.017G020266.1 pacid=42813149 polypeptide=Potri.017G020266.1.p locus=Potri.017G020266 ID=Potri.017G020266.1.v4.1 annot-version=v4.1
ATGCTGAAAGGAGCAGCGATAGATTTCAGTCCATTAACCGCTTGGGGCGTTCTTGGTGGAAGTGTTCATTTCACTCAAAGAAATGGAAGCATTAGTTTGC
TTGAGGGGGCATTTCGACTGGCATCCTTGAACTATATACTGTCTCATAGTAATGCCTTAGCCCTACCCTCGCTTTCCTTTTGTGTCATTTCAGTTAATAG
GATTTCTTGA
AA sequence
>Potri.017G020266.1 pacid=42813149 polypeptide=Potri.017G020266.1.p locus=Potri.017G020266 ID=Potri.017G020266.1.v4.1 annot-version=v4.1
MLKGAAIDFSPLTAWGVLGGSVHFTQRNGSISLLEGAFRLASLNYILSHSNALALPSLSFCVISVNRIS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.017G020266 0 1
AT2G20060 Ribosomal protein L4/L1 family... Potri.006G270501 45.11 0.7027
AT5G18470 Curculin-like (mannose-binding... Potri.005G015300 59.16 0.6700
AT5G10940 ASG2 ALTERED SEED GERMINATION 2, tr... Potri.002G103066 67.64 0.6699
AT5G01270 CPL2, ATCPL2 carboxyl-terminal domain (ctd)... Potri.016G114600 101.02 0.5922
AT1G77380 AAP3, ATAAP3 amino acid permease 3 (.1) Potri.004G174150 136.46 0.6391
AT3G49490 unknown protein Potri.002G230100 147.13 0.6276
Potri.008G216423 153.79 0.5657
AT2G30580 BMI1A, DRIP2 DREB2A-interacting protein 2 (... Potri.005G054400 163.01 0.5732
AT5G15640 Mitochondrial substrate carrie... Potri.004G117000 196.22 0.5747

Potri.017G020266 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.