Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G59510 129 / 8e-36 Leucine-rich repeat (LRR) family protein (.1) AT2G15320 80 / 6e-18 Leucine-rich repeat (LRR) family protein (.1) AT5G66330 75 / 3e-16 Leucine-rich repeat (LRR) family protein (.1) AT4G03010 52 / 2e-08 RNI-like superfamily protein (.1) AT1G03440 52 / 3e-08 Leucine-rich repeat (LRR) family protein (.1) AT1G07550 52 / 5e-08 Leucine-rich repeat protein kinase family protein (.1) AT5G59680 51 / 9e-08 Leucine-rich repeat protein kinase family protein (.1) AT5G59660 51 / 1e-07 Leucine-rich repeat protein kinase family protein (.1) AT3G47570 50 / 1e-07 Leucine-rich repeat protein kinase family protein (.1) AT1G60800 50 / 1e-07 NIK3 NSP-interacting kinase 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G028400 [exp] 319 / 3e-109 AT3G59510 366 / 6e-124 Leucine-rich repeat (LRR) family protein (.1) Potri.017G028600 [exp] 245 / 7e-81 AT3G59510 372 / 8e-127 Leucine-rich repeat (LRR) family protein (.1) Potri.001G301400 [exp] 81 / 3e-18 AT2G15320 429 / 6e-150 Leucine-rich repeat (LRR) family protein (.1) Potri.009G097100 [exp] 79 / 1e-17 AT2G15320 473 / 2e-167 Leucine-rich repeat (LRR) family protein (.1) Potri.005G234400 [exp] 79 / 2e-17 AT5G66330 412 / 3e-142 Leucine-rich repeat (LRR) family protein (.1) Potri.005G117800 [exp] 74 / 7e-16 AT5G66330 506 / 2e-179 Leucine-rich repeat (LRR) family protein (.1) Potri.007G016800 [exp] 74 / 9e-16 AT5G66330 480 / 8e-169 Leucine-rich repeat (LRR) family protein (.1) Potri.012G044500 [exp] 56 / 2e-09 AT3G47570 764 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.014G136100 [exp] 55 / 5e-09 AT1G03440 541 / 0.0 Leucine-rich repeat (LRR) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019356 [exp] 156 / 4e-46 AT3G59510 377 / 1e-128 Leucine-rich repeat (LRR) family protein (.1) Lus10007417 [exp] 154 / 2e-45 AT3G59510 379 / 2e-129 Leucine-rich repeat (LRR) family protein (.1) Lus10025578 [exp] 146 / 1e-42 AT3G59510 388 / 6e-133 Leucine-rich repeat (LRR) family protein (.1) Lus10028359 [exp] 65 / 2e-12 AT5G66330 423 / 5e-147 Leucine-rich repeat (LRR) family protein (.1) Lus10008190 [exp] 56 / 2e-09 AT1G03440 576 / 0.0 Leucine-rich repeat (LRR) family protein (.1) Lus10027967 [exp] 53 / 1e-08 AT1G03440 268 / 3e-92 Leucine-rich repeat (LRR) family protein (.1) Lus10009394 [exp] 52 / 6e-08 AT3G47570 642 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030591 [exp] 50 / 2e-07 AT1G60800 929 / 0.0 NSP-interacting kinase 3 (.1) Lus10030898 [exp] 50 / 3e-07 AT1G60800 931 / 0.0 NSP-interacting kinase 3 (.1) Lus10038598 [exp] 49 / 5e-07 AT3G47570 671 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.017G028325.1 pacid=42813580 polypeptide=Potri.017G028325.1.p locus=Potri.017G028325 ID=Potri.017G028325.1.v4.1 annot-version=v4.1 ATGAATCATCTATTATCAGAATGCCATTATAAGTGTGCGAAGTCTTTGATAGCCAAGCAAACCATCGAAAGTTTAGATCGCCTGCCTTCCCTTGAACCAA TGGCCAAACAACTGCACTCCCTCCTTTCTTCTTGCTTGCTTTCTGTCACTGTATCCATAGTTCTACTCCATATACCAACTCGAGTACATTCAGTAACATT GAAATCAGATGTTGAAGCCCTTCAGGCACTGATGCAGGCCGTCGATCCCGTCTCGATTGTGAGGTATTCCTACCTCCATAGCTGGGATTTCGCATTCGAT CCATGTGAGGCTGCAGGGGTATTTCAAGGGATCTTGTGCACATTCCCTACAGACAAATCGGCCAACCGTATAATGGCAATTGATCTTGATCCTGCTGGGT ATGATGGCTTTCTAACAGCATCGATCGGGAATCTGACAGAGCTTACCTCCCTTAGGATAAGCAAAAACAACTTTCGAGGGCCAATACCAGAAACCATAGC CAACCTTCAGAAGCTCACCTAG
AA sequence Show only first row Show all	>Potri.017G028325.1 pacid=42813580 polypeptide=Potri.017G028325.1.p locus=Potri.017G028325 ID=Potri.017G028325.1.v4.1 annot-version=v4.1 MNHLLSECHYKCAKSLIAKQTIESLDRLPSLEPMAKQLHSLLSSCLLSVTVSIVLLHIPTRVHSVTLKSDVEALQALMQAVDPVSIVRYSYLHSWDFAFD PCEAAGVFQGILCTFPTDKSANRIMAIDLDPAGYDGFLTASIGNLTELTSLRISKNNFRGPIPETIANLQKLT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G59510			Leucine-rich repeat (LRR) fami...		Potri.017G028325 [exp]	0	1
AT3G59510			Leucine-rich repeat (LRR) fami...		Potri.017G028400 [exp]	1.00	0.8290
AT3G12410			Polynucleotidyl transferase, r...		Potri.011G116000 [exp]	36.33	0.6592
					Potri.003G152300 [exp]	65.29	0.6369
					Potri.003G152250 [exp]	78.36	0.6396
AT5G28040	GeBP		DNA-binding storekeeper protei...		Potri.001G261700 [exp]	100.31	0.6292
AT3G51790		ATG1	transmembrane protein G1P-rela...		Potri.003G205200 [exp]	132.92	0.5991
AT3G11450			DnaJ domain ;Myb-like DNA-bind...		Potri.001G035800 [exp]	184.48	0.5862

Compare expression of checked genes

Potri.017G028325 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.