Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G43280 319 / 5e-112 FAR1_related Far-red impaired responsive (FAR1) family protein (.1) AT3G07500 171 / 9e-54 FAR1_related Far-red impaired responsive (FAR1) family protein (.1) AT4G12850 163 / 6e-51 FAR1_related Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2), Far-red impaired responsive (FAR1) family protein (.3) AT3G59470 146 / 2e-43 FAR1_related Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2) AT4G38180 108 / 4e-27 FAR1_related FRS5 FAR1-related sequence 5 (.1) AT2G32250 84 / 9e-19 FAR1_related FRS2 FAR1-related sequence 2 (.1.2.3.4) AT4G15090 81 / 1e-17 FAR1_related FAR1 FAR-RED IMPAIRED RESPONSE 1, FRS (FAR1 Related Sequences) transcription factor family (.1) AT3G06250 81 / 2e-17 FAR1_related FRS7 FAR1-related sequence 7 (.1) AT5G18960 80 / 2e-17 FAR1_related FRS12 FAR1-related sequence 12 (.1) AT3G22170 77 / 2e-16 FAR1_related FHY3 far-red elongated hypocotyls 3 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G239400 [exp] 202 / 3e-66 AT4G12850 207 / 1e-68 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2), Far-red impaired responsive (FAR1) family protein (.3) Potri.014G176600 [exp] 199 / 2e-64 AT4G12850 178 / 5e-57 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2), Far-red impaired responsive (FAR1) family protein (.3) Potri.014G176500 [exp] 196 / 3e-63 AT3G07500 275 / 2e-94 Far-red impaired responsive (FAR1) family protein (.1) Potri.007G129101 [exp] 174 / 5e-56 AT2G43280 142 / 6e-44 Far-red impaired responsive (FAR1) family protein (.1) Potri.007G129000 [exp] 139 / 9e-42 AT2G43280 133 / 9e-40 Far-red impaired responsive (FAR1) family protein (.1) Potri.007G129500 [exp] 142 / 1e-41 AT3G59470 260 / 9e-88 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2) Potri.007G128900 [exp] 140 / 4e-41 AT3G07500 154 / 2e-46 Far-red impaired responsive (FAR1) family protein (.1) Potri.002G239300 [exp] 137 / 1e-39 AT2G43280 130 / 2e-37 Far-red impaired responsive (FAR1) family protein (.1) Potri.017G029100 [exp] 136 / 2e-39 AT3G59470 323 / 1e-112 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025517 [exp] 94 / 6e-25 AT2G43280 87 / 1e-22 Far-red impaired responsive (FAR1) family protein (.1) Lus10026732 [exp] 89 / 2e-22 AT3G07500 88 / 2e-22 Far-red impaired responsive (FAR1) family protein (.1) Lus10020226 [exp] 86 / 4e-20 AT3G59470 120 / 7e-33 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2) Lus10026854 [exp] 83 / 1e-18 AT3G59470 121 / 1e-32 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2) Lus10022979 [exp] 41 / 0.0002 AT4G38180 85 / 8e-20 FAR1-related sequence 5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0274 [poplar] [flax] WRKY-GCM1 PF03101 [poplar] [flax] FAR1 FAR1 DNA-binding domain
Representative CDS sequence Show only first row Show all	>Potri.017G029400.2 pacid=42813915 polypeptide=Potri.017G029400.2.p locus=Potri.017G029400 ID=Potri.017G029400.2.v4.1 annot-version=v4.1 ATGCAAATGGATGTAGATGAGAGGATTGATATAGCAGAGAGCTCTATTGGAAATGAATTGGTTGAACATGGTGGTGAATTGGTTGAACATGAAGGTGATG ATATGGTTGTAGAACCACATGAGGGCATGGAGTTTGAATCAGAAGATGCTGCCAAGATATTCTATGATGAATATGCCCGGCGGATAGGATTTGTAATGCG TGTAATGTCTTGTCGTCGTTCTGAAAGAGATGGGAGGATTCTTGCCAGGCGACTTGGGTGTAATAAGGAGGGTTATTGTGTAAGCATTCGAGGGAAATTT GGAAATGTTCGAAAGCCACGACCAAGTACTAGAGAAGGTTGTAAAGCAATGATTCATGTTAAGTTTGATAAGTCTGGAAAATGGGTGATAACGAAATTTG TAAAGGACCATAATCATCCACTTGTAGTGGCCCCACGTGAAGCTCGTCAAACGTTGGATGAAAAAGACAAAAAAATTCAAGAATTAACTGCTGAATTGAG AAATAAGAAGCGGTTATGTGCCACTTATCAAGAACAGCTAAGTGCATTTGTGAAAATTGTTGAAGATCACAGTGAGAAGCTATCCAAGAAAGTTAAAAAT GCGGTAGAAAATCTAAAAGAATTTGAGTCTATTGAGCAGGAGCTCATGCAGCATACATAG
AA sequence Show only first row Show all	>Potri.017G029400.2 pacid=42813915 polypeptide=Potri.017G029400.2.p locus=Potri.017G029400 ID=Potri.017G029400.2.v4.1 annot-version=v4.1 MQMDVDERIDIAESSIGNELVEHGGELVEHEGDDMVVEPHEGMEFESEDAAKIFYDEYARRIGFVMRVMSCRRSERDGRILARRLGCNKEGYCVSIRGKF GNVRKPRPSTREGCKAMIHVKFDKSGKWVITKFVKDHNHPLVVAPREARQTLDEKDKKIQELTAELRNKKRLCATYQEQLSAFVKIVEDHSEKLSKKVKN AVENLKEFESIEQELMQHT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G43280	FAR1_related		Far-red impaired responsive (F...		Potri.017G029400 [exp]	0	1
AT3G27100			unknown protein		Potri.001G330400 [exp]	10.04	0.7831
AT5G37930			Protein with RING/U-box and TR...		Potri.017G148100 [exp]	16.43	0.7782
					Potri.018G055900 [exp]	26.66	0.7575
AT2G43760			molybdopterin biosynthesis Moa...		Potri.001G272100 [exp]	28.46	0.6883
					Potri.010G010851 [exp]	34.52	0.7566
					Potri.014G061700 [exp]	40.84	0.7487
AT1G15900			unknown protein		Potri.001G046900 [exp]	47.53	0.7367
AT1G30290			Tetratricopeptide repeat (TPR)...		Potri.011G082300 [exp]	51.43	0.7409
					Potri.003G152950 [exp]	53.27	0.7354
AT1G80450			VQ motif-containing protein (....		Potri.006G266700 [exp]	60.44	0.6623

Compare expression of checked genes

Potri.017G029400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.