Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G43310 154 / 2e-49 Ribosomal L18p/L5e family protein (.1) AT3G45020 40 / 5e-05 Ribosomal L18p/L5e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G128100 [exp] 219 / 4e-75 AT2G43310 129 / 1e-39 Ribosomal L18p/L5e family protein (.1) Potri.004G214400 [exp] 44 / 3e-06 AT3G45020 194 / 2e-65 Ribosomal L18p/L5e family protein (.1) Potri.007G100900 [exp] 42 / 1e-05 AT5G27820 155 / 3e-50 Ribosomal L18p/L5e family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016132 [exp] 41 / 3e-05 AT3G45020 196 / 5e-66 Ribosomal L18p/L5e family protein (.1) Lus10021433 [exp] 40 / 6e-05 AT3G45020 200 / 8e-68 Ribosomal L18p/L5e family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.017G030200.1 pacid=42814094 polypeptide=Potri.017G030200.1.p locus=Potri.017G030200 ID=Potri.017G030200.1.v4.1 annot-version=v4.1 ATGCCAGGGAATCAGCAACATCTCCTTCGGCTAGTCCTGTCCTGCCGGAAAATAACAGCACAGGTAACAAATCCGACGACTTCCACAATAATCGCCATGG CTTCCTCCGCTGAGCAAGAATCCTTCCTCTCTCACTACCGCAACACCACTCTCTCTCGCTTCCCTCGCCAATCCTGGGACTCAAAAGCGGCGTCGCGCGT CGGGGAGAAATTAGGTTTTAGATTAAAGGGAATTGGTGTTAGTAACATCTATATTGATTTAAACGAAGAGTTGTCAAGGTCGATTCATTATAGAAAGCGT GTGTTACCGTTGTTTGATTCGGTGAAACGCGTTGGCATTGTAGTTGATGGAGCTGAGAAGCTGGGAGAGATCGGTCATGTTTGA
AA sequence Show only first row Show all	>Potri.017G030200.1 pacid=42814094 polypeptide=Potri.017G030200.1.p locus=Potri.017G030200 ID=Potri.017G030200.1.v4.1 annot-version=v4.1 MPGNQQHLLRLVLSCRKITAQVTNPTTSTIIAMASSAEQESFLSHYRNTTLSRFPRQSWDSKAASRVGEKLGFRLKGIGVSNIYIDLNEELSRSIHYRKR VLPLFDSVKRVGIVVDGAEKLGEIGHV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G43310			Ribosomal L18p/L5e family prot...		Potri.017G030200 [exp]	0	1
AT5G63220			unknown protein		Potri.008G044100 [exp]	9.48	0.8378
AT5G45750		AtRABA1c	RAB GTPase homolog A1C (.1)		Potri.011G070300 [exp]	10.67	0.8562
AT1G51650			ATP synthase epsilon chain, mi...		Potri.010G250000 [exp]	11.74	0.8697
AT2G42210		ATOEP16-3	Mitochondrial import inner mem...		Potri.006G059300 [exp]	12.48	0.8708
AT4G20150			unknown protein		Potri.001G074901 [exp]	16.37	0.8495
AT5G19760			Mitochondrial substrate carrie...		Potri.001G004500 [exp]	17.66	0.8182
AT4G18800		AthSGBP, AtRab1...	RAB GTPase homolog A1D (.1)		Potri.004G061000 [exp]	20.12	0.7741
AT1G16000			unknown protein		Potri.003G183501 [exp]	23.51	0.8346
AT1G14450			NADH dehydrogenase (ubiquinone...		Potri.004G229900 [exp]	26.66	0.8259
AT5G54750			Transport protein particle (TR...		Potri.001G418400 [exp]	30.29	0.8355

Compare expression of checked genes

Potri.017G030200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.