Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31500 93 / 4e-24 CPK24 calcium-dependent protein kinase 24 (.1) AT3G57530 89 / 2e-22 ATCPK32, CDPK32, CPK32 calcium-dependent protein kinase 32 (.1) AT5G19450 88 / 3e-22 CPK8, CDPK19 calcium-dependent protein kinase 19 (.1.2) AT5G12480 86 / 1e-21 CPK7 calmodulin-domain protein kinase 7 (.1.2) AT2G41860 82 / 3e-20 CPK14 calcium-dependent protein kinase 14 (.1.2) AT3G51850 78 / 1e-18 CPK13 calcium-dependent protein kinase 13 (.1) AT3G20410 77 / 3e-18 CPK9 calmodulin-domain protein kinase 9 (.1) AT1G74740 74 / 3e-17 CDPK1A, CPK30, ATCPK30 CALCIUM-DEPENDENT PROTEIN KINASE 1A, calcium-dependent protein kinase 30 (.1) AT1G50700 72 / 1e-16 CPK33 calcium-dependent protein kinase 33 (.1) AT5G12180 70 / 7e-16 CPK17 calcium-dependent protein kinase 17 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G127000 [exp] 105 / 1e-28 AT2G31500 744 / 0.0 calcium-dependent protein kinase 24 (.1) Potri.016G054600 [exp] 82 / 4e-20 AT3G57530 864 / 0.0 calcium-dependent protein kinase 32 (.1) Potri.006G052900 [exp] 82 / 5e-20 AT3G57530 863 / 0.0 calcium-dependent protein kinase 32 (.1) Potri.001G257100 [exp] 81 / 7e-20 AT5G12480 903 / 0.0 calmodulin-domain protein kinase 7 (.1.2) Potri.009G052700 [exp] 80 / 2e-19 AT5G19450 903 / 0.0 calcium-dependent protein kinase 19 (.1.2) Potri.016G117200 [exp] 79 / 6e-19 AT3G51850 982 / 0.0 calcium-dependent protein kinase 13 (.1) Potri.006G101300 [exp] 78 / 1e-18 AT3G51850 977 / 0.0 calcium-dependent protein kinase 13 (.1) Potri.009G069200 [exp] 71 / 3e-16 AT5G12180 914 / 0.0 calcium-dependent protein kinase 17 (.1) Potri.012G071700 [exp] 71 / 3e-16 AT1G74740 931 / 0.0 CALCIUM-DEPENDENT PROTEIN KINASE 1A, calcium-dependent protein kinase 30 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027032 [exp] 97 / 3e-25 AT2G31500 765 / 0.0 calcium-dependent protein kinase 24 (.1) Lus10025570 [exp] 96 / 4e-25 AT2G31500 768 / 0.0 calcium-dependent protein kinase 24 (.1) Lus10027361 [exp] 82 / 6e-20 AT5G19450 909 / 0.0 calcium-dependent protein kinase 19 (.1.2) Lus10042370 [exp] 82 / 6e-20 AT3G57530 820 / 0.0 calcium-dependent protein kinase 32 (.1) Lus10014907 [exp] 82 / 7e-20 AT5G19450 896 / 0.0 calcium-dependent protein kinase 19 (.1.2) Lus10030134 [exp] 81 / 1e-19 AT5G19450 783 / 0.0 calcium-dependent protein kinase 19 (.1.2) Lus10009947 [exp] 80 / 2e-19 AT5G19450 889 / 0.0 calcium-dependent protein kinase 19 (.1.2) Lus10002482 [exp] 80 / 3e-19 AT3G51850 979 / 0.0 calcium-dependent protein kinase 13 (.1) Lus10026742 [exp] 78 / 1e-18 AT3G57530 793 / 0.0 calcium-dependent protein kinase 32 (.1) Lus10005038 [exp] 78 / 1e-18 AT3G51850 793 / 0.0 calcium-dependent protein kinase 13 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF00069 [poplar] [flax] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Potri.017G031900.2 pacid=42813398 polypeptide=Potri.017G031900.2.p locus=Potri.017G031900 ID=Potri.017G031900.2.v4.1 annot-version=v4.1 ATGAGGCATTTGCCTAAACATCCTAATATTGCAAGCTTCAAGGAGGCATATGAGGATAGAGATGCTGTTCGTCTTGTCATGGAACTTTGCAAGGGAGGTG AGTTTTTTTATAGGATTGTTTCTAAACGGAATTGCACCGATCGTGCTGCGGCAATGGTTACCAAGACCATTTTGGAGAGTGTCAAGGTATTGCCATTCTA TAGATTAGGATAA
AA sequence Show only first row Show all	>Potri.017G031900.2 pacid=42813398 polypeptide=Potri.017G031900.2.p locus=Potri.017G031900 ID=Potri.017G031900.2.v4.1 annot-version=v4.1 MRHLPKHPNIASFKEAYEDRDAVRLVMELCKGGEFFYRIVSKRNCTDRAAAMVTKTILESVKVLPFYRLG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G31500		CPK24	calcium-dependent protein kina...		Potri.017G031900 [exp]	0	1
AT3G58480			calmodulin-binding family prot...		Potri.006G197500 [exp]	10.39	0.8789
AT5G66910			Disease resistance protein (CC...		Potri.007G039201 [exp]	17.40	0.8753
					Potri.014G065300 [exp]	22.44	0.8737
					Potri.014G163733 [exp]	28.87	0.8689
AT5G11390		WIT1	WPP domain-interacting protein...		Potri.004G111350 [exp]	37.41	0.8673
AT5G20940			Glycosyl hydrolase family prot...		Potri.009G154032 [exp]	39.10	0.8665
					Potri.018G055900 [exp]	41.56	0.8628
AT4G10950			SGNH hydrolase-type esterase s...		Potri.003G141300 [exp]	47.32	0.8639
AT4G14805			Bifunctional inhibitor/lipid-t...		Potri.010G085000 [exp]	52.15	0.8617
AT2G38890			unknown protein		Potri.008G044500 [exp]	53.83	0.8607

Compare expression of checked genes

Potri.017G031900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.