Potri.017G034500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G38280 337 / 4e-111 PR5K PR5-like receptor kinase (.1)
AT5G38260 336 / 5e-111 Protein kinase superfamily protein (.1)
AT1G70250 334 / 2e-108 receptor serine/threonine kinase, putative (.1)
AT1G66910 329 / 4e-108 Protein kinase superfamily protein (.1)
AT1G66980 335 / 1e-106 GDPDL2, SNC4 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1)
AT4G18250 330 / 2e-106 receptor serine/threonine kinase, putative (.1)
AT5G39030 327 / 1e-105 Protein kinase superfamily protein (.1)
AT5G39020 323 / 3e-104 Malectin/receptor-like protein kinase family protein (.1)
AT1G66920 316 / 2e-103 Protein kinase superfamily protein (.1.2)
AT5G38240 312 / 3e-102 Protein kinase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G125800 526 / 0 AT5G38260 308 / 1e-95 Protein kinase superfamily protein (.1)
Potri.007G125000 525 / 0 AT5G38260 318 / 7e-100 Protein kinase superfamily protein (.1)
Potri.007G125450 519 / 0 AT5G38260 300 / 2e-92 Protein kinase superfamily protein (.1)
Potri.007G125200 518 / 0 AT5G38260 300 / 2e-94 Protein kinase superfamily protein (.1)
Potri.007G126100 494 / 2e-172 AT1G70250 290 / 3e-87 receptor serine/threonine kinase, putative (.1)
Potri.015G122000 482 / 5e-172 AT5G38280 336 / 2e-110 PR5-like receptor kinase (.1)
Potri.017G009100 493 / 1e-171 AT5G38280 331 / 1e-103 PR5-like receptor kinase (.1)
Potri.017G009400 488 / 9e-170 AT5G38280 329 / 4e-103 PR5-like receptor kinase (.1)
Potri.017G009000 471 / 3e-168 AT5G38280 306 / 3e-99 PR5-like receptor kinase (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025545 444 / 1e-157 AT5G39020 316 / 1e-101 Malectin/receptor-like protein kinase family protein (.1)
Lus10022359 448 / 2e-155 AT1G66980 322 / 3e-101 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1)
Lus10025492 448 / 2e-154 AT5G38260 326 / 1e-102 Protein kinase superfamily protein (.1)
Lus10008335 447 / 3e-153 AT1G70250 316 / 8e-98 receptor serine/threonine kinase, putative (.1)
Lus10014924 435 / 2e-149 AT1G67000 349 / 5e-112 Protein kinase superfamily protein (.1)
Lus10027085 369 / 1e-128 AT1G66980 275 / 1e-84 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1)
Lus10025553 348 / 2e-115 AT1G70250 341 / 4e-108 receptor serine/threonine kinase, putative (.1)
Lus10008362 340 / 1e-113 AT1G66930 250 / 7e-75 Protein kinase superfamily protein (.1)
Lus10025547 335 / 2e-111 AT1G66920 345 / 2e-111 Protein kinase superfamily protein (.1.2)
Lus10026761 334 / 2e-111 AT1G67000 334 / 4e-107 Protein kinase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence
>Potri.017G034500.1 pacid=42813941 polypeptide=Potri.017G034500.1.p locus=Potri.017G034500 ID=Potri.017G034500.1.v4.1 annot-version=v4.1
ATGCCAGTAAGATATTCCTATTCAGATATCAAGAAGATTACTAGAGGTTTCAAGGACGAATTGGGTAAAGGAGGCTTTGGTACAGTTTACAAAGGAAAGC
TTCGCAGTGGACGTTTTGCAGCAATAAAATTGTTGGGAAAATCAAAAGCTAATGGACAGGATTTCATAAATGAAGTTGCTACCATAGGAAGGATTCACCA
TACTAATGTGGTGCAGCTAATTGGTTTTTGCGCCGAAGGATCAAAACGTGCTCTTGTATATGATTTCATGCCTAATGGATCTCTTGATAGTCACTTGTTT
TCTCAAGAAGGATCAATCTCTTTAAGCTGGCAAAAACTGCATCAGATTTCCCTTGGTGTGGCTTGTGGTATCGACTATCTCCATTTAGGTTGTGACATGC
AAATACTGCATTTTGATATCAAGCCTCACAACATTCTCCTCGACGAAAATTTCACTCCAAAAGTCTCTGACTTCGGGCTCGCTAGGTTGTACCCAACGAA
TGGCAGCATCACATCTCTCACTGCAGCAAGGGGCACCATCGGATACATGGCTCCTGAATTGTTCTACAAAAACATTGGACGCGTCTCATATAAAGCTGAT
GTCTATAGCTTCGGAATGCTGCTATTGGAAATGGCAGGCAAAAGAAAGAATCTAAATGCTTTGGCAGAAAATTCAAGTCAAATCTACTGGCCATATTGGG
TTCATGACCAAGTATCTGATGGAAAGGCCATAGAAATCGGAGACGATGCCACTGAGGAAGAAAGTAAGATCGTTAAGAAGATGATTATGGTTGGATTGTG
GTGTATACAAATGAAACCCATGGATCGGCCTACAATGAAGAATGTTGTGGAGATGCTTGAAGGAGATTTGGAAAACTTGCGATTGCCTCCTAAGCCTGTC
TTCAATGTAGATGAGACGCCAACAAACATTGAAGGAGAGTCATCATCGTTGTCAGGTGATTCTACCGAATCAACCAGTTTGGTTGAAAATGCATACTGA
AA sequence
>Potri.017G034500.1 pacid=42813941 polypeptide=Potri.017G034500.1.p locus=Potri.017G034500 ID=Potri.017G034500.1.v4.1 annot-version=v4.1
MPVRYSYSDIKKITRGFKDELGKGGFGTVYKGKLRSGRFAAIKLLGKSKANGQDFINEVATIGRIHHTNVVQLIGFCAEGSKRALVYDFMPNGSLDSHLF
SQEGSISLSWQKLHQISLGVACGIDYLHLGCDMQILHFDIKPHNILLDENFTPKVSDFGLARLYPTNGSITSLTAARGTIGYMAPELFYKNIGRVSYKAD
VYSFGMLLLEMAGKRKNLNALAENSSQIYWPYWVHDQVSDGKAIEIGDDATEEESKIVKKMIMVGLWCIQMKPMDRPTMKNVVEMLEGDLENLRLPPKPV
FNVDETPTNIEGESSSLSGDSTESTSLVENAY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G38260 Protein kinase superfamily pro... Potri.017G034500 0 1
AT4G23200 CRK12 cysteine-rich RLK (RECEPTOR-li... Potri.018G111700 3.46 0.9619
AT1G05680 UGT74E2 Uridine diphosphate glycosyltr... Potri.017G032500 5.47 0.9537 ZOG1.12
AT3G51550 FER FERONIA, Malectin/receptor-lik... Potri.017G096600 6.32 0.9481
AT1G66920 Protein kinase superfamily pro... Potri.017G117065 7.41 0.9447
AT5G23670 ATLCB2, LCB2 long chain base2 (.1.2) Potri.015G103800 10.24 0.9437 LJLCB2.1
AT4G33090 ATAPM1, APM1 aminopeptidase M1 (.1) Potri.017G039200 14.49 0.9418
AT4G37000 ATRCCR, ACD2 ARABIDOPSIS THALIANA RED CHLOR... Potri.007G043700 15.29 0.9445
AT1G05680 UGT74E2 Uridine diphosphate glycosyltr... Potri.017G032700 15.55 0.9387
AT1G79600 Protein kinase superfamily pro... Potri.002G000100 17.23 0.9429
AT3G57680 Peptidase S41 family protein (... Potri.006G055400 17.29 0.9369

Potri.017G034500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.