Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30740 46 / 4e-07 Protein kinase superfamily protein (.1) AT3G59350 46 / 5e-07 Protein kinase superfamily protein (.1.2.3) AT2G43230 46 / 5e-07 Protein kinase superfamily protein (.1.2) AT1G06700 43 / 7e-06 Protein kinase superfamily protein (.1.2) AT2G30730 40 / 6e-05 Protein kinase superfamily protein (.1) AT2G41970 39 / 0.0001 Protein kinase superfamily protein (.1) AT2G47060 39 / 0.0001 PTI1-4 Pto-interacting 1-4, Protein kinase superfamily protein (.1.2.3.4.5) AT1G48210 38 / 0.0003 Protein kinase superfamily protein (.1.2) AT3G17410 38 / 0.0004 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G124000 [exp] 46 / 4e-07 AT2G43230 582 / 0.0 Protein kinase superfamily protein (.1.2) Potri.017G036300 [exp] 46 / 4e-07 AT3G59350 632 / 0.0 Protein kinase superfamily protein (.1.2.3) Potri.006G194000 [exp] 40 / 6e-05 AT2G41970 586 / 0.0 Protein kinase superfamily protein (.1) Potri.016G059600 [exp] 40 / 6e-05 AT2G41970 600 / 0.0 Protein kinase superfamily protein (.1) Potri.002G188600 [exp] 39 / 0.0002 AT3G62220 595 / 0.0 Protein kinase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026706 [exp] 46 / 4e-07 AT3G59350 613 / 0.0 Protein kinase superfamily protein (.1.2.3) Lus10025496 [exp] 46 / 4e-07 AT3G59350 610 / 0.0 Protein kinase superfamily protein (.1.2.3) Lus10026708 [exp] 46 / 4e-07 AT3G59350 625 / 0.0 Protein kinase superfamily protein (.1.2.3) Lus10025498 [exp] 46 / 4e-07 AT3G59350 630 / 0.0 Protein kinase superfamily protein (.1.2.3) Lus10029295 [exp] 42 / 2e-05 AT2G41970 562 / 0.0 Protein kinase superfamily protein (.1) Lus10016247 [exp] 42 / 2e-05 AT2G41970 563 / 0.0 Protein kinase superfamily protein (.1) Lus10017242 [exp] 42 / 2e-05 AT2G41970 560 / 0.0 Protein kinase superfamily protein (.1) Lus10021070 [exp] 42 / 2e-05 AT2G41970 562 / 0.0 Protein kinase superfamily protein (.1) Lus10038042 [exp] 39 / 0.0002 AT3G62220 588 / 0.0 Protein kinase superfamily protein (.1) Lus10009983 [exp] 39 / 0.0002 AT3G62220 586 / 0.0 Protein kinase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.017G036501.1 pacid=42814581 polypeptide=Potri.017G036501.1.p locus=Potri.017G036501 ID=Potri.017G036501.1.v4.1 annot-version=v4.1 ATGAATGATGTTAACAGTTCTGGAGTGGCTCTCCTGTTGATCATACCAGACCATGTGGGCAGAATAGTCTGTTACATGGATGAGTTCTCTGTCCTGGCTA CCCTAAGACTGAGAGAAGACATAGTTAAATTATGTATAGATCCCAAGCTGAAGGGAGAATATCCACCTCAAGTTGACAAGGCACTTGGACTAGACCTATT CATGCGCAGCAGGAGGATTGTTTTGAGCTGGATCAATTGCTTTCTGCATTCTTTCCTCCTAGTGTTGACGACATGA
AA sequence Show only first row Show all	>Potri.017G036501.1 pacid=42814581 polypeptide=Potri.017G036501.1.p locus=Potri.017G036501 ID=Potri.017G036501.1.v4.1 annot-version=v4.1 MNDVNSSGVALLLIIPDHVGRIVCYMDEFSVLATLRLREDIVKLCIDPKLKGEYPPQVDKALGLDLFMRSRRIVLSWINCFLHSFLLVLTT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G30740			Protein kinase superfamily pro...		Potri.017G036501 [exp]	0	1
AT3G18110		EMB1270	embryo defective 1270, Pentatr...		Potri.017G036400 [exp]	4.47	0.8808
AT3G61700			Plant protein 1589 of unknown ...		Potri.012G001900 [exp]	4.69	0.8391
AT1G14205			Ribosomal L18p/L5e family prot...		Potri.008G087100 [exp]	7.07	0.8400
AT1G12700		RPF1	RNA processing factor 1, ATP b...		Potri.005G046200 [exp]	7.74	0.8246
AT1G45110			Tetrapyrrole (Corrin/Porphyrin...		Potri.005G232200 [exp]	8.48	0.8493
AT4G18240		ATSS4, SSIV	ARABIDOPSIS THALIANA STARCH SY...		Potri.001G351800 [exp]	15.00	0.8597
AT4G34830		PDE346, MRL1	PIGMENT DEFECTIVE 346, MATURAT...		Potri.004G166600 [exp]	15.29	0.8797
AT5G36930			Disease resistance protein (TI...		Potri.011G012750 [exp]	18.33	0.8174
AT3G17630		ATCHX19	cation/H+ exchanger 19, cation...		Potri.010G005200 [exp]	21.07	0.8379
AT2G43280	FAR1_related		Far-red impaired responsive (F...		Potri.007G129000 [exp]	21.72	0.7601

Compare expression of checked genes

Potri.017G036501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.