Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05870 123 / 5e-39 APC11 anaphase-promoting complex/cyclosome 11 (.1.2) AT5G20570 48 / 8e-09 HRT1, ROC1, RBX1, ATRBX1 REGULATOR OF CULLINS-1, RING-box 1 (.1.2.3) AT3G42830 45 / 7e-08 RING/U-box superfamily protein (.1) AT3G48030 43 / 1e-06 hypoxia-responsive family protein / zinc finger (C3HC4-type RING finger) family protein (.1) AT1G72220 42 / 3e-06 RING/U-box superfamily protein (.1) AT5G40250 40 / 1e-05 RING/U-box superfamily protein (.1) AT5G37280 40 / 1e-05 RING/U-box superfamily protein (.1) AT5G17600 40 / 2e-05 RING/U-box superfamily protein (.1) AT5G66070 39 / 4e-05 RING/U-box superfamily protein (.1.2) AT4G25230 39 / 4e-05 RIN2 RPM1 interacting protein 2 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G167400 [exp] 47 / 8e-09 AT5G20570 203 / 3e-69 REGULATOR OF CULLINS-1, RING-box 1 (.1.2.3) Potri.006G141300 [exp] 47 / 8e-09 AT5G20570 209 / 1e-71 REGULATOR OF CULLINS-1, RING-box 1 (.1.2.3) Potri.003G067100 [exp] 47 / 1e-08 AT5G20570 206 / 2e-70 REGULATOR OF CULLINS-1, RING-box 1 (.1.2.3) Potri.002G140600 [exp] 45 / 2e-07 AT3G60220 194 / 3e-59 TOXICOS EN LEVADURA 4 (.1) Potri.018G085001 [exp] 41 / 8e-06 AT4G28890 290 / 2e-94 RING/U-box superfamily protein (.1) Potri.014G053600 [exp] 40 / 2e-05 AT3G60220 148 / 1e-41 TOXICOS EN LEVADURA 4 (.1) Potri.007G061400 [exp] 39 / 3e-05 AT2G17730 351 / 8e-124 NEP-interacting protein 2 (.1.2) Potri.005G108200 [exp] 39 / 5e-05 AT4G35840 369 / 7e-131 RING/U-box superfamily protein (.1) Potri.011G147900 [exp] 39 / 5e-05 AT5G47610 123 / 1e-35 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015126 [exp] 114 / 1e-34 AT3G05870 156 / 2e-50 anaphase-promoting complex/cyclosome 11 (.1.2) Lus10031549 [exp] 115 / 5e-34 AT3G05870 158 / 6e-50 anaphase-promoting complex/cyclosome 11 (.1.2) Lus10015667 [exp] 47 / 1e-08 AT5G20570 200 / 5e-68 REGULATOR OF CULLINS-1, RING-box 1 (.1.2.3) Lus10013153 [exp] 47 / 1e-08 AT5G20570 206 / 2e-70 REGULATOR OF CULLINS-1, RING-box 1 (.1.2.3) Lus10009511 [exp] 43 / 2e-06 AT2G20030 228 / 3e-71 RING/U-box superfamily protein (.1) Lus10011702 [exp] 42 / 3e-06 AT4G28890 231 / 1e-71 RING/U-box superfamily protein (.1) Lus10032270 [exp] 42 / 3e-06 AT5G41350 192 / 2e-61 RING/U-box superfamily protein (.1) Lus10024635 [exp] 40 / 2e-05 AT5G41350 178 / 7e-57 RING/U-box superfamily protein (.1) Lus10026534 [exp] 40 / 3e-05 AT5G03450 317 / 3e-101 Transducin/WD40 repeat-like superfamily protein (.1) Lus10012745 [exp] 39 / 5e-05 AT4G33565 168 / 4e-49 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF12861 [poplar] [flax] zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger
Representative CDS sequence Show only first row Show all	>Potri.017G037701.2 pacid=42813062 polypeptide=Potri.017G037701.2.p locus=Potri.017G037701 ID=Potri.017G037701.2.v4.1 annot-version=v4.1 ATGGCCTTTGATGGTTGCTGTCCTGATTGTAAACTCCCTGGGGATGATTGCCCACTTATTTGGGGTGCATGCAACCATGCGTTCCATCTTCATTGCATCT TGAAATGGGTGAATTCACAGACATCACAAGCACACTGTCCCATGTGCCGAAGGGAATGGCAGTTCAAGGAATAA
AA sequence Show only first row Show all	>Potri.017G037701.2 pacid=42813062 polypeptide=Potri.017G037701.2.p locus=Potri.017G037701 ID=Potri.017G037701.2.v4.1 annot-version=v4.1 MAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTSQAHCPMCRREWQFKE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G05870		APC11	anaphase-promoting complex/cyc...		Potri.017G037701 [exp]	0	1
AT3G60600		(AT)VAP, (AT)VA...	VAMP/SYNAPTOBREVIN-ASSOCIATED ...		Potri.002G144000 [exp]	4.89	0.8499
AT3G52580			Ribosomal protein S11 family p...		Potri.001G218700 [exp]	5.65	0.8618
AT4G36130			Ribosomal protein L2 family (....		Potri.007G013101 [exp]	10.67	0.8509
AT3G05590		RPL18	ribosomal protein L18 (.1)		Potri.005G023500 [exp]	11.48	0.8601	Pt-RPL18.12
AT3G04400		EMB2171	embryo defective 2171, Ribosom...		Potri.010G066400 [exp]	14.66	0.8460	Pt-RPL23.6
AT1G26880			Ribosomal protein L34e superfa...		Potri.017G082200 [exp]	16.79	0.8426	Pt-RPL34.5
AT5G20920		EIF2 BETA, EMB1...	embryo defective 1401, eukaryo...		Potri.019G131200 [exp]	18.13	0.8370	EIF2.2
AT1G77750			Ribosomal protein S13/S18 fami...		Potri.002G088400 [exp]	19.89	0.8246
AT4G33865			Ribosomal protein S14p/S29e fa...		Potri.009G090000 [exp]	21.23	0.8199
AT3G16980		NRPE9A, NRPD9A,...	RNA polymerases M/15 Kd subuni...		Potri.008G106900 [exp]	21.90	0.7979

Compare expression of checked genes

Potri.017G037701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.