Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G05260 130 / 1e-38 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) AT3G21770 121 / 3e-35 Peroxidase superfamily protein (.1) AT4G11290 113 / 4e-32 Peroxidase superfamily protein (.1) AT5G15180 91 / 2e-23 Peroxidase superfamily protein (.1) AT3G01190 87 / 3e-22 Peroxidase superfamily protein (.1) AT5G39580 69 / 2e-15 Peroxidase superfamily protein (.1.2) AT1G05240 68 / 5e-15 Peroxidase superfamily protein (.1) AT1G05250 68 / 5e-15 Peroxidase superfamily protein (.1) AT2G24800 66 / 3e-14 Peroxidase superfamily protein (.1) AT5G64120 62 / 5e-13 Peroxidase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G037900 [exp] 160 / 3e-50 AT1G05260 481 / 2e-172 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) Potri.007G122100 [exp] 153 / 1e-47 AT1G05260 496 / 3e-178 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) Potri.017G038100 [exp] 127 / 3e-37 AT1G05260 479 / 7e-172 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) Potri.012G042800 [exp] 89 / 1e-22 AT1G05260 336 / 2e-115 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) Potri.019G063201 [exp] 86 / 8e-22 AT3G01190 412 / 4e-145 Peroxidase superfamily protein (.1) Potri.011G027300 [exp] 84 / 7e-21 AT3G01190 407 / 2e-143 Peroxidase superfamily protein (.1) Potri.004G023100 [exp] 84 / 8e-21 AT3G01190 403 / 1e-141 Peroxidase superfamily protein (.1) Potri.004G023200 [exp] 84 / 1e-20 AT3G01190 404 / 5e-142 Peroxidase superfamily protein (.1) Potri.007G122301 [exp] 83 / 1e-20 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027164 [exp] 126 / 7e-37 AT1G05260 463 / 3e-165 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) Lus10039680 [exp] 125 / 1e-36 AT1G05260 458 / 3e-163 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) Lus10015127 [exp] 123 / 7e-36 AT1G05260 444 / 7e-158 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) Lus10031548 [exp] 122 / 3e-35 AT1G05260 441 / 1e-156 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) Lus10039681 [exp] 120 / 1e-34 AT4G11290 488 / 3e-175 Peroxidase superfamily protein (.1) Lus10027163 [exp] 120 / 1e-34 AT4G11290 491 / 4e-176 Peroxidase superfamily protein (.1) Lus10007638 [exp] 84 / 1e-20 AT3G01190 407 / 4e-143 Peroxidase superfamily protein (.1) Lus10018374 [exp] 82 / 3e-20 AT3G01190 414 / 4e-146 Peroxidase superfamily protein (.1) Lus10006756 [exp] 80 / 2e-19 AT3G01190 379 / 3e-132 Peroxidase superfamily protein (.1) Lus10021956 [exp] 72 / 2e-16 AT2G39040 323 / 6e-108 Peroxidase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0617 [poplar] [flax] Peroxidase PF00141 [poplar] [flax] peroxidase Peroxidase
Representative CDS sequence Show only first row Show all	>Potri.017G038000.2 pacid=42813042 polypeptide=Potri.017G038000.2.p locus=Potri.017G038000 ID=Potri.017G038000.2.v4.1 annot-version=v4.1 ATGGACCCTGGAAGTTCCAGGACATTTGATCTTAGCTACTACAGGCTCTTACTCAAGAGACGAGGTCTCTTCCAGTCTGATTCTGCCTTAACCACAAACT CCACTACATTGTCATTCGTCAACCAGCTGCTCCAAGGTTCACTTGAGAATTTCTTTGCTGAATTCGCAGATTCCATGGAGAAAATGGGCAGAATCAACGT TAAGAGTACTGGCACAGTTGGAGAGATCAGAAAGCAGTGTGCAGTGGTGAATAGCTAA
AA sequence Show only first row Show all	>Potri.017G038000.2 pacid=42813042 polypeptide=Potri.017G038000.2.p locus=Potri.017G038000 ID=Potri.017G038000.2.v4.1 annot-version=v4.1 MDPGSSRTFDLSYYRLLLKRRGLFQSDSALTTNSTTLSFVNQLLQGSLENFFAEFADSMEKMGRINVKSTGTVGEIRKQCAVVNS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G05260		RCI3A, RCI3	RARE COLD INDUCIBLE GENE 3, Pe...		Potri.017G038000 [exp]	0	1
AT1G05260		RCI3A, RCI3	RARE COLD INDUCIBLE GENE 3, Pe...		Potri.017G037900 [exp]	5.09	0.8228
AT3G15680			Ran BP2/NZF zinc finger-like s...		Potri.003G061300 [exp]	8.83	0.8459
AT1G09750			Eukaryotic aspartyl protease f...		Potri.002G104600 [exp]	17.60	0.8118
AT4G22010		SKS4	SKU5 similar 4 (.1)		Potri.014G154500 [exp]	21.90	0.8157
AT5G58600		TBL44, PMR5	TRICHOME BIREFRINGENCE-LIKE 44...		Potri.001G278300 [exp]	27.01	0.7775
AT4G13870		WRNEXO, ATWRNEX...	Werner syndrome-like exonuclea...		Potri.016G028700 [exp]	28.21	0.8119
AT3G15680			Ran BP2/NZF zinc finger-like s...		Potri.001G172700 [exp]	34.29	0.8108
AT5G41050			Pollen Ole e 1 allergen and ex...		Potri.017G068400 [exp]	37.34	0.7517
AT5G05830			RING/FYVE/PHD zinc finger supe...		Potri.010G195100 [exp]	42.53	0.7544
AT4G39700			Heavy metal transport/detoxifi...		Potri.007G087300 [exp]	42.66	0.7834

Compare expression of checked genes

Potri.017G038000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.