Potri.017G038300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G26400 69 / 1e-13 RING/U-box superfamily protein (.1.2)
AT1G55530 65 / 2e-12 RING/U-box superfamily protein (.1)
AT5G56340 65 / 2e-12 ATCRT1 RING/U-box superfamily protein (.1)
AT3G13430 64 / 3e-12 RING/U-box superfamily protein (.1.2.3)
AT5G59550 62 / 3e-11 zinc finger (C3HC4-type RING finger) family protein (.1)
AT1G60360 61 / 7e-11 RING/U-box superfamily protein (.1)
AT3G19950 61 / 7e-11 RING/U-box superfamily protein (.1)
AT1G14200 59 / 7e-11 RING/U-box superfamily protein (.1)
AT2G40830 60 / 1e-10 RHC1A RING-H2 finger C1A (.1.2.3)
AT2G44330 58 / 1e-10 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G102800 211 / 2e-69 AT3G13430 69 / 9e-14 RING/U-box superfamily protein (.1.2.3)
Potri.001G103900 63 / 3e-12 AT4G26400 85 / 2e-19 RING/U-box superfamily protein (.1.2)
Potri.007G118000 62 / 8e-12 AT1G18760 81 / 1e-18 Zinc finger, C3HC4 type (RING finger) family protein (.1)
Potri.005G062400 62 / 1e-11 AT1G60360 82 / 3e-18 RING/U-box superfamily protein (.1)
Potri.002G083001 61 / 2e-11 AT1G18760 81 / 1e-18 Zinc finger, C3HC4 type (RING finger) family protein (.1)
Potri.003G223200 62 / 3e-11 AT5G56340 301 / 3e-99 RING/U-box superfamily protein (.1)
Potri.001G001500 62 / 3e-11 AT5G56340 323 / 2e-108 RING/U-box superfamily protein (.1)
Potri.007G107000 61 / 3e-11 AT1G18760 79 / 7e-18 Zinc finger, C3HC4 type (RING finger) family protein (.1)
Potri.010G168300 61 / 4e-11 AT1G26800 195 / 4e-63 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013397 63 / 1e-11 AT5G56340 330 / 5e-111 RING/U-box superfamily protein (.1)
Lus10010179 62 / 2e-11 AT3G19950 285 / 6e-96 RING/U-box superfamily protein (.1)
Lus10030755 62 / 3e-11 AT2G40830 336 / 2e-115 RING-H2 finger C1A (.1.2.3)
Lus10013235 62 / 3e-11 AT2G40830 334 / 7e-115 RING-H2 finger C1A (.1.2.3)
Lus10020258 60 / 2e-10 AT1G19800 469 / 4e-161 ATP-binding cassette I14, trigalactosyldiacylglycerol 1 (.1.2.3)
Lus10040783 59 / 2e-10 AT5G59550 228 / 1e-72 zinc finger (C3HC4-type RING finger) family protein (.1)
Lus10025671 59 / 2e-10 AT3G13228 74 / 4e-15 RING/U-box superfamily protein (.1)
Lus10002637 59 / 3e-10 AT1G55530 257 / 4e-82 RING/U-box superfamily protein (.1)
Lus10025612 58 / 5e-10 AT1G60360 234 / 7e-75 RING/U-box superfamily protein (.1)
Lus10017383 55 / 5e-10 AT3G19950 127 / 8e-37 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.017G038300.1 pacid=42814082 polypeptide=Potri.017G038300.1.p locus=Potri.017G038300 ID=Potri.017G038300.1.v4.1 annot-version=v4.1
ATGGAGCCATCGTCATCTTCTGTCTATTCAACTCAGTTTCTTGCCAAAAAGGTTACTGTAGAGTTCATTATTGTCAAGGAATCGCAAGTTGGCTTACAGG
TTAGTAGACAACAATTCCTGTTGAGACTGTGGGAGTTGGTGTTGAGAAATCATAGATACAAGCAAATGTTTACCAACACAGACATCAGTTTATCTTCAGC
CATGAAAGCTACTCTGCCCTTCGCCATCTCTGATCAGGCTCGTAAACTCCACGGTGAAATTGACCACATATTTGTCTGCGTTCTGCACCCGAGGTTCAAT
ATCATGACTGGCATTCATGTTGATGAGGATAAGGCGGTCTCGTGGGATGTTGTCGAAAACCCTGAAAATCCTGTATTACCAGCTTGCAAGCCACCGATCC
CATGCTTGAAGAAAGTAAAGATTGAGCAACAAACTCCGGGTTCCATGAATGAAGAGTTATGCTGTGCAATTTGCTTGCAAGATTTTCCTGATGGGTCTGA
AGCTGCTACTACTAGATGCTCTCACCTGTTTCATTGCCATTGCATTGTCAAGTGGCTATCCAAGAGTACTTCTTGCCCTATGTGTCGCACTAAGCTGCCA
GTTGGTTGA
AA sequence
>Potri.017G038300.1 pacid=42814082 polypeptide=Potri.017G038300.1.p locus=Potri.017G038300 ID=Potri.017G038300.1.v4.1 annot-version=v4.1
MEPSSSSVYSTQFLAKKVTVEFIIVKESQVGLQVSRQQFLLRLWELVLRNHRYKQMFTNTDISLSSAMKATLPFAISDQARKLHGEIDHIFVCVLHPRFN
IMTGIHVDEDKAVSWDVVENPENPVLPACKPPIPCLKKVKIEQQTPGSMNEELCCAICLQDFPDGSEAATTRCSHLFHCHCIVKWLSKSTSCPMCRTKLP
VG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G26400 RING/U-box superfamily protein... Potri.017G038300 0 1
AT4G25315 Expressed protein (.1.2) Potri.004G189300 1.41 0.8605
AT4G17180 O-Glycosyl hydrolases family 1... Potri.006G002100 2.82 0.8264
AT5G04520 Protein of unknown function DU... Potri.010G233000 3.00 0.8325
AT3G19508 unknown protein Potri.009G094200 5.47 0.8142
AT2G32060 Ribosomal protein L7Ae/L30e/S1... Potri.003G181200 8.36 0.7783
AT2G06010 ORG4 OBP3-responsive gene 4 (.1) Potri.018G065800 8.71 0.7488 ORG4.2
AT5G07900 Mitochondrial transcription te... Potri.004G012400 10.00 0.7460
AT3G62810 complex 1 family protein / LVR... Potri.014G129800 10.19 0.7871
AT5G35530 Ribosomal protein S3 family pr... Potri.012G076800 12.00 0.7861
AT2G45440 DHDPS2 dihydrodipicolinate synthase (... Potri.002G149500 12.48 0.7690 Pt-DHDPS2.1

Potri.017G038300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.