Potri.017G039125 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G45221 44 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT1G57775 44 / 3e-06 Protein of unknown function (DUF784) (.1)
AT1G45215 43 / 8e-06 Protein of unknown function (DUF784) (.1)
AT2G04041 39 / 0.0003 Protein of unknown function (DUF784) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G039150 233 / 2e-80 AT3G30383 49 / 3e-08 Protein of unknown function (DUF784) (.1)
Potri.017G029250 233 / 4e-80 AT3G30387 50 / 2e-08 Protein of unknown function (DUF784) (.1)
Potri.017G039175 231 / 2e-79 AT5G34883 51 / 6e-09 Protein of unknown function (DUF784) (.1)
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0482 Prolamin PF05617 Prolamin_like Prolamin-like
Representative CDS sequence
>Potri.017G039125.1 pacid=42813950 polypeptide=Potri.017G039125.1.p locus=Potri.017G039125 ID=Potri.017G039125.1.v4.1 annot-version=v4.1
ATGGCAAGGTCTAACAACTTTTTATTCATGGTGCTTCTGTTCTTGGGAATAGTGTTAATAGTCTCTCCTGTCCTTGCCATTGAGAATGACGATGAATCAA
CCGCAGCTGAATATATTGATGATGAAAATCTAGCTGTATCACCAGAAAGTTCTACGGAGATTTTGCCGGGTTTTTTGAAAAATTGTGCAAATACTATTTC
AAAGGCTGCTGGAGACAAAGTCTTCAATTACATATTTGGGAATGAAAACAACCTGGACTACGCCACTTGTAGTGAAGTCACGGGATCCGGTAAAGAATGC
AACGGTGCTCTGGTGAAATATGTTGCTGAAGGGCCAATGTTTAAGGCCAATTATGATTTTTATTGGAAAAGGGGTGAAGACTTATATAATTTTTGCTCGT
CTGTGTTCATGGGTTGGGCACATATTTCCTTTTGA
AA sequence
>Potri.017G039125.1 pacid=42813950 polypeptide=Potri.017G039125.1.p locus=Potri.017G039125 ID=Potri.017G039125.1.v4.1 annot-version=v4.1
MARSNNFLFMVLLFLGIVLIVSPVLAIENDDESTAAEYIDDENLAVSPESSTEILPGFLKNCANTISKAAGDKVFNYIFGNENNLDYATCSEVTGSGKEC
NGALVKYVAEGPMFKANYDFYWKRGEDLYNFCSSVFMGWAHISF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G30387 Protein of unknown function (D... Potri.017G039125 0 1
AT4G22080 RHS14 root hair specific 14 (.1) Potri.004G007300 7.54 0.7313
AT1G61566 RALFL9 ralf-like 9 (.1) Potri.018G007600 8.48 0.6045
AT5G47670 CCAAT NF-YB6, L1L "nuclear factor Y, subunit B6"... Potri.006G005000 8.71 0.7313
AT3G02100 UDP-Glycosyltransferase superf... Potri.010G084900 12.64 0.7044
AT2G38770 EMB2765 EMBRYO DEFECTIVE 2765, P-loop ... Potri.001G024401 13.49 0.5711
AT5G13620 unknown protein Potri.008G045000 15.58 0.6654
AT4G35720 Arabidopsis protein of unknown... Potri.005G103800 18.02 0.6332
AT4G33550 Bifunctional inhibitor/lipid-t... Potri.009G048800 18.33 0.6315
Potri.007G009000 18.46 0.6378
AT5G26330 Cupredoxin superfamily protein... Potri.006G259000 19.59 0.6060

Potri.017G039125 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.