Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22060 133 / 2e-40 Receptor-like protein kinase-related family protein (.1) AT3G58310 122 / 5e-36 Domain of unknown function (DUF26) (.1) AT2G31620 101 / 8e-28 Receptor-like protein kinase-related family protein (.1) AT3G21945 99 / 1e-27 Receptor-like protein kinase-related family protein (.1) AT3G21990 99 / 1e-26 Domain of unknown function (DUF26) (.1) AT4G20670 97 / 5e-26 Domain of unknown function (DUF26) (.1) AT3G21940 94 / 6e-25 Receptor protein kinase-related (.1) AT3G22050 94 / 8e-25 Domain of unknown function (DUF26) (.1) AT3G22010 93 / 2e-24 Receptor-like protein kinase-related family protein (.1) AT3G22000 91 / 2e-23 Domain of unknown function (DUF26) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G039966 [exp] 200 / 2e-66 AT3G22060 273 / 5e-93 Receptor-like protein kinase-related family protein (.1) Potri.017G040450 [exp] 198 / 1e-65 AT3G22060 274 / 4e-93 Receptor-like protein kinase-related family protein (.1) Potri.007G120401 [exp] 177 / 1e-57 AT3G22060 271 / 3e-92 Receptor-like protein kinase-related family protein (.1) Potri.007G120400 [exp] 177 / 1e-57 AT3G22060 270 / 8e-92 Receptor-like protein kinase-related family protein (.1) Potri.007G120500 [exp] 174 / 3e-56 AT3G22060 278 / 6e-95 Receptor-like protein kinase-related family protein (.1) Potri.007G120700 [exp] 170 / 1e-54 AT3G22060 275 / 2e-93 Receptor-like protein kinase-related family protein (.1) Potri.007G120501 [exp] 166 / 5e-53 AT3G22060 271 / 4e-92 Receptor-like protein kinase-related family protein (.1) Potri.007G120300 [exp] 124 / 9e-37 AT3G22060 194 / 1e-61 Receptor-like protein kinase-related family protein (.1) Potri.007G120601 [exp] 120 / 7e-36 AT3G22060 199 / 9e-65 Receptor-like protein kinase-related family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027145 [exp] 132 / 8e-40 AT3G22060 253 / 8e-85 Receptor-like protein kinase-related family protein (.1) Lus10039699 [exp] 127 / 2e-37 AT3G22060 171 / 5e-52 Receptor-like protein kinase-related family protein (.1) Lus10018377 [exp] 87 / 2e-21 AT4G05200 489 / 4e-164 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10018382 [exp] 86 / 6e-21 AT4G21410 605 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Lus10007632 [exp] 86 / 1e-20 AT4G05200 624 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10018380 [exp] 83 / 7e-20 AT4G05200 324 / 2e-104 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10018379 [exp] 82 / 2e-19 AT4G23180 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10003660 [exp] 80 / 3e-19 AT4G05200 117 / 3e-29 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10027144 [exp] 76 / 1e-18 ND 121 / 1e-34 Lus10007634 [exp] 78 / 4e-18 AT4G23160 417 / 1e-137 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01657 [poplar] [flax] Stress-antifung Salt stress response/antifungal
Representative CDS sequence Show only first row Show all	>Potri.017G039883.1 pacid=42814088 polypeptide=Potri.017G039883.1.p locus=Potri.017G039883 ID=Potri.017G039883.1.v4.1 annot-version=v4.1 ATGCACGTTATGAGTGAGCCAGCTCCATTCAATAAAAAGACCAAAGAGCTTTTGAGCCAGCTTGCCAATAAAGCTCAAGCAACCCCCAAGTTGTTTGCAA CAGGAGAGAGGGAACTAGGAAAATCAACCAAGCTTTATGGTCTGGTTCAGTGCACTGGGGATCTTTCTAGTGCTGTTTGTAAGAAATGCCTTGATGGTAT AATTGGTGAACTCCCAAGCTGCTGTGATGGGAAACAAGGTGGCAGGGTTGTTAGTGGGAGTTGCAATTTCATATATGAAATATACCCTTTTGTCAATGCT TAA
AA sequence Show only first row Show all	>Potri.017G039883.1 pacid=42814088 polypeptide=Potri.017G039883.1.p locus=Potri.017G039883 ID=Potri.017G039883.1.v4.1 annot-version=v4.1 MHVMSEPAPFNKKTKELLSQLANKAQATPKLFATGERELGKSTKLYGLVQCTGDLSSAVCKKCLDGIIGELPSCCDGKQGGRVVSGSCNFIYEIYPFVNA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G22060			Receptor-like protein kinase-r...		Potri.017G039883 [exp]	0	1
AT1G53440			Leucine-rich repeat transmembr...		Potri.016G011400 [exp]	10.58	0.7827
AT4G13440			Calcium-binding EF-hand family...		Potri.019G026820 [exp]	15.42	0.7702
					Potri.018G090350 [exp]	18.08	0.7681
AT5G26960			Galactose oxidase/kelch repeat...		Potri.009G066500 [exp]	21.33	0.5986
					Potri.002G252050 [exp]	21.63	0.7509
					Potri.014G003683 [exp]	32.44	0.7509
					Potri.019G073801 [exp]	37.46	0.7509
AT4G13440			Calcium-binding EF-hand family...		Potri.019G027440 [exp]	38.66	0.7476
AT5G44120		ATCRA1, CRU1, C...	CRUCIFERINA, RmlC-like cupins ...		Potri.019G004300 [exp]	41.29	0.7016
					Potri.001G004900 [exp]	42.16	0.7461

Compare expression of checked genes

Potri.017G039883 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.