Potri.017G040450 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22060 273 / 7e-93 Receptor-like protein kinase-related family protein (.1)
AT3G58310 227 / 2e-74 Domain of unknown function (DUF26) (.1)
AT3G21990 169 / 8e-52 Domain of unknown function (DUF26) (.1)
AT4G20670 167 / 5e-51 Domain of unknown function (DUF26) (.1)
AT2G31620 160 / 2e-48 Receptor-like protein kinase-related family protein (.1)
AT3G21960 155 / 3e-46 Receptor-like protein kinase-related family protein (.1.2)
AT4G20640 155 / 1e-44 Protein with domains of unknown function (DUF26 and DUF1204) (.1)
AT4G20620 155 / 1e-44 Protein with domains of unknown function (DUF26 and DUF1204) (.1)
AT4G20610 155 / 1e-44 Protein with domains of unknown function (DUF26 and DUF1204) (.1)
AT4G20570 155 / 1e-44 Protein with domains of unknown function (DUF26 and DUF1204) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G039966 481 / 3e-175 AT3G22060 273 / 5e-93 Receptor-like protein kinase-related family protein (.1)
Potri.007G120401 427 / 6e-154 AT3G22060 271 / 3e-92 Receptor-like protein kinase-related family protein (.1)
Potri.007G120400 426 / 2e-153 AT3G22060 270 / 8e-92 Receptor-like protein kinase-related family protein (.1)
Potri.007G120500 421 / 3e-151 AT3G22060 278 / 6e-95 Receptor-like protein kinase-related family protein (.1)
Potri.007G120700 416 / 1e-149 AT3G22060 275 / 2e-93 Receptor-like protein kinase-related family protein (.1)
Potri.007G120501 401 / 1e-143 AT3G22060 271 / 4e-92 Receptor-like protein kinase-related family protein (.1)
Potri.017G040049 272 / 2e-92 AT3G22060 221 / 9e-72 Receptor-like protein kinase-related family protein (.1)
Potri.017G040300 266 / 3e-90 AT3G22060 226 / 3e-74 Receptor-like protein kinase-related family protein (.1)
Potri.007G120300 256 / 5e-86 AT3G22060 194 / 1e-61 Receptor-like protein kinase-related family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027145 257 / 2e-86 AT3G22060 253 / 8e-85 Receptor-like protein kinase-related family protein (.1)
Lus10018382 177 / 3e-51 AT4G21410 605 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Lus10007632 172 / 2e-49 AT4G05200 624 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10039699 163 / 3e-49 AT3G22060 171 / 5e-52 Receptor-like protein kinase-related family protein (.1)
Lus10038227 157 / 3e-47 AT5G48540 261 / 1e-87 receptor-like protein kinase-related family protein (.1)
Lus10018380 161 / 7e-47 AT4G05200 324 / 2e-104 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10018377 152 / 4e-42 AT4G05200 489 / 4e-164 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10025875 144 / 5e-42 AT5G48540 261 / 2e-87 receptor-like protein kinase-related family protein (.1)
Lus10026629 141 / 2e-38 AT4G23180 540 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Lus10007634 139 / 7e-38 AT4G23160 417 / 1e-137 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Potri.017G040450.1 pacid=42812990 polypeptide=Potri.017G040450.1.p locus=Potri.017G040450 ID=Potri.017G040450.1.v4.1 annot-version=v4.1
ATGTCTTTCTCCAACTTTGCCTTCTCTCTATGTCTAATAACCTTTTCTCTCCTTCTCCACACTGTTTTTGGAGCAGGCCCAAATTTCCATTTATGTTCAT
CTCCTGAGAACTTCACTGCCAATGGCCCTTATGAATCCAACCTAAACAAGCTCACTAGTTACCTTTACTATAAAGCCCCTCCTACAGGTTTTGGTATGGG
TTCAAGAGGCCACACCCCGGACCAAACATACGGGCTTGCTCTTTGTAGAGGTGATGTCTCAACTTCAGATTGCAAAACCTGTGTTGTTGAGGTGAGCAGT
GAGATTCGAAAGCGCTGCCCATACAACAAAGCAGCTATCATTTGGTATGATAACTGCCTTTTGAAGTACTCAAACAATGCGTTCTTTGGCCAAATTGATA
ATGGAAACAAGTTCTACATGTGGAACGTGCACGTTGTGAGTGAGCCTGCTCCATTCAATGAGAAGACCAAAGAGCTTTTGAGCCAGCTTGCCAATGAAGC
TCAAGCAACCCCCAAGTTGTTTGCAACAGGAGAGAGGGAACTAGGAAAATCAACCAAGCTTTATGGTCTGGTTCAGTGCACTGGGGATCTTTCTAGTGCT
GTTTGTAAGAAATGCCTTGATGGTATAATTGGGGAACTCCCAATCTGCTGTGATGGGAAACAAGGTGGCAGGGTTGTTAGCGGGAGTTGCAATTTCATAT
ATGAAATATACCCTTTTGTCAATGCTTAA
AA sequence
>Potri.017G040450.1 pacid=42812990 polypeptide=Potri.017G040450.1.p locus=Potri.017G040450 ID=Potri.017G040450.1.v4.1 annot-version=v4.1
MSFSNFAFSLCLITFSLLLHTVFGAGPNFHLCSSPENFTANGPYESNLNKLTSYLYYKAPPTGFGMGSRGHTPDQTYGLALCRGDVSTSDCKTCVVEVSS
EIRKRCPYNKAAIIWYDNCLLKYSNNAFFGQIDNGNKFYMWNVHVVSEPAPFNEKTKELLSQLANEAQATPKLFATGERELGKSTKLYGLVQCTGDLSSA
VCKKCLDGIIGELPICCDGKQGGRVVSGSCNFIYEIYPFVNA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G22060 Receptor-like protein kinase-r... Potri.017G040450 0 1
AT3G22060 Receptor-like protein kinase-r... Potri.017G039966 1.41 0.8734
AT3G22060 Receptor-like protein kinase-r... Potri.007G120400 9.48 0.6564
AT3G26040 HXXXD-type acyl-transferase fa... Potri.010G054100 12.24 0.6697
AT1G16180 Serinc-domain containing serin... Potri.003G186500 16.58 0.6238
AT5G40760 G6PD6 glucose-6-phosphate dehydrogen... Potri.001G337400 28.98 0.6093 ACG12.1
AT3G51750 unknown protein Potri.006G103600 30.39 0.5481
AT2G41690 HSF AT-HSFB3, HSFB3 HEAT SHOCK TRANSCRIPTION FACTO... Potri.006G049200 31.40 0.5960 Pt-HSFB3.1
AT5G25820 Exostosin family protein (.1) Potri.006G239000 31.74 0.6583
AT3G22060 Receptor-like protein kinase-r... Potri.007G120501 32.32 0.6877
AT4G31940 CYP82C4 "cytochrome P450, family 82, s... Potri.014G037400 39.11 0.5924

Potri.017G040450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.