Potri.017G040750 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.017G040750.1 pacid=42812959 polypeptide=Potri.017G040750.1.p locus=Potri.017G040750 ID=Potri.017G040750.1.v4.1 annot-version=v4.1
ATGAACTCTTACGCCACCGCCTTCACAAATCACACAAATGCTCTGGTGACGACGATGATTGTCACCCTCCAATTAACCTTCCCTAATCCTACCACAAGTG
GACCTTCTGGGCTGACCCCACCTAGCGCGGGCATCTACCAATTCAGTCCACCACCACCTACCCCACCGGACAGTGGCACTAACCTACATCCACCACCACC
CCCACCTACCCCACCGGACATTGGCACTAACCTACCTCCACCACCACCTCCTCCTCCTCTTCTGCTGTCACCGCCGCCTCCTGCTGTGCCTGCTGTAACT
GGGGCGCCACCTCCTTCTAATAATCCGCCGAGTAGTACTGTGTTAGTGACTCCAGGTCCTGTTCATGCTTAG
AA sequence
>Potri.017G040750.1 pacid=42812959 polypeptide=Potri.017G040750.1.p locus=Potri.017G040750 ID=Potri.017G040750.1.v4.1 annot-version=v4.1
MNSYATAFTNHTNALVTTMIVTLQLTFPNPTTSGPSGLTPPSAGIYQFSPPPPTPPDSGTNLHPPPPPPTPPDIGTNLPPPPPPPPLLLSPPPPAVPAVT
GAPPPSNNPPSSTVLVTPGPVHA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.017G040750 0 1
AT5G50290 unknown protein Potri.015G078700 10.77 0.8548
Potri.001G049700 12.00 0.8341
AT3G01680 SEOR1, SEOb Sieve-Element-Occlusion-Relate... Potri.010G050200 18.49 0.8354
AT5G14920 Gibberellin-regulated family p... Potri.015G071500 18.70 0.7726
AT5G22580 Stress responsive A/B Barrel D... Potri.004G187500 22.80 0.8303
AT4G31980 unknown protein Potri.013G146600 24.69 0.8299
AT3G50160 Plant protein of unknown funct... Potri.006G042300 36.08 0.8275
AT5G15100 ATPIN8, PIN8 PIN-FORMED 8, Auxin efflux car... Potri.017G078300 36.53 0.8019 PIN14
AT1G71140 MATE efflux family protein (.1... Potri.004G093400 36.82 0.8070
AT5G01225 unknown protein Potri.016G112700 36.98 0.7817

Potri.017G040750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.