Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G49690 66 / 5e-14 UDP-Glycosyltransferase superfamily protein (.1) AT2G22590 64 / 3e-13 UDP-Glycosyltransferase superfamily protein (.1) AT5G65550 54 / 7e-10 UDP-Glycosyltransferase superfamily protein (.1) AT5G53990 40 / 7e-05 UDP-Glycosyltransferase superfamily protein (.1) AT1G01420 38 / 0.0004 UGT72B3 UDP-glucosyl transferase 72B3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G042800 [exp] 97 / 8e-25 AT5G49690 377 / 3e-127 UDP-Glycosyltransferase superfamily protein (.1) Potri.014G088400 [exp] 81 / 3e-19 AT2G22590 374 / 4e-125 UDP-Glycosyltransferase superfamily protein (.1) Potri.002G162300 [exp] 80 / 7e-19 AT2G22590 372 / 6e-125 UDP-Glycosyltransferase superfamily protein (.1) Potri.001G030600 [exp] 73 / 2e-16 AT2G22590 537 / 0.0 UDP-Glycosyltransferase superfamily protein (.1) Potri.012G034100 [exp] 68 / 9e-15 AT2G22590 505 / 2e-177 UDP-Glycosyltransferase superfamily protein (.1) Potri.010G182575 [exp] 62 / 1e-12 AT5G49690 468 / 7e-163 UDP-Glycosyltransferase superfamily protein (.1) Potri.018G140401 [exp] 52 / 3e-10 AT2G22590 88 / 3e-22 UDP-Glycosyltransferase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026411 [exp] 67 / 1e-15 AT5G65550 94 / 8e-24 UDP-Glycosyltransferase superfamily protein (.1) Lus10025711 [exp] 69 / 8e-15 AT2G22590 473 / 2e-164 UDP-Glycosyltransferase superfamily protein (.1) Lus10042242 [exp] 67 / 3e-14 AT5G65550 280 / 9e-92 UDP-Glycosyltransferase superfamily protein (.1) Lus10035951 [exp] 66 / 6e-14 AT2G22590 464 / 3e-161 UDP-Glycosyltransferase superfamily protein (.1) Lus10012726 [exp] 64 / 6e-13 AT2G22590 471 / 3e-164 UDP-Glycosyltransferase superfamily protein (.1) Lus10027850 [exp] 45 / 2e-06 AT5G49690 560 / 0.0 UDP-Glycosyltransferase superfamily protein (.1) Lus10026410 [exp] 41 / 2e-05 AT5G65550 82 / 1e-18 UDP-Glycosyltransferase superfamily protein (.1) Lus10026927 [exp] 40 / 7e-05 AT2G15480 310 / 2e-100 UDP-glucosyl transferase 73B5 (.1.2) Lus10020124 [exp] 40 / 0.0001 AT2G15490 301 / 4e-97 UDP-glycosyltransferase 73B4 (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.017G042650.1 pacid=42813680 polypeptide=Potri.017G042650.1.p locus=Potri.017G042650 ID=Potri.017G042650.1.v4.1 annot-version=v4.1 ATGCCTATGGTAGCTGACCAAGGTCTTAATGCCAAGCTTTTATTCGAGAAAGGAAATGGCTTTCAGGTGCAAAGCAATGAAGATGGCGCACACAACCAAG ACTCAATTGCCATGTCCCTGAGATTCGTGATAGCAGATCAAGAAGGACAGCATTTACGGTTTCGGGCAGCTGAAATGCAAACAATTTTTGCTAACCAGGA TCTACATGATAACTATACAGAGGAGTTTGTTGAGTTTATTTTCAACCATAAGAAAAGGCAAGATTTGAGTTTTCATGGAAAGGCTAGCTGGGGGAAAACA TCTGTATAA
AA sequence Show only first row Show all	>Potri.017G042650.1 pacid=42813680 polypeptide=Potri.017G042650.1.p locus=Potri.017G042650 ID=Potri.017G042650.1.v4.1 annot-version=v4.1 MPMVADQGLNAKLLFEKGNGFQVQSNEDGAHNQDSIAMSLRFVIADQEGQHLRFRAAEMQTIFANQDLHDNYTEEFVEFIFNHKKRQDLSFHGKASWGKT SV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G49690			UDP-Glycosyltransferase superf...		Potri.017G042650 [exp]	0	1
AT1G30280			Chaperone DnaJ-domain superfam...		Potri.004G133100 [exp]	12.48	0.8472
					Potri.004G188950 [exp]	13.49	0.8472
AT5G42905			Polynucleotidyl transferase, r...		Potri.019G032650 [exp]	16.12	0.8472
					Potri.002G262601 [exp]	17.02	0.7589
					Potri.014G114801 [exp]	18.38	0.8472
					Potri.015G129650 [exp]	21.44	0.7938
AT5G63060			Sec14p-like phosphatidylinosit...		Potri.012G088350 [exp]	21.90	0.8330
					Potri.015G072666 [exp]	22.95	0.8269
AT3G22910			ATPase E1-E2 type family prote...		Potri.016G009101 [exp]	23.23	0.8122
					Potri.002G196500 [exp]	24.37	0.7839

Compare expression of checked genes

Potri.017G042650 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.