Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	SAUR56
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29500 130 / 7e-40 SAUR-like auxin-responsive protein family (.1) AT5G27780 129 / 3e-39 SAUR-like auxin-responsive protein family (.1) AT1G29450 127 / 2e-38 SAUR-like auxin-responsive protein family (.1) AT1G29460 125 / 1e-37 SAUR-like auxin-responsive protein family (.1) AT1G29420 124 / 3e-37 SAUR-like auxin-responsive protein family (.1) AT1G29510 113 / 8e-33 SAUR68 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) AT1G29430 112 / 2e-32 SAUR-like auxin-responsive protein family (.1) AT1G29440 108 / 8e-31 SAUR-like auxin-responsive protein family (.1) AT1G29490 100 / 4e-28 SAUR-like auxin-responsive protein family (.1) AT1G76190 78 / 3e-19 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G043400 [exp] 194 / 9e-65 AT5G27780 141 / 8e-44 SAUR-like auxin-responsive protein family (.1) Potri.004G181400 [exp] 190 / 3e-63 AT1G29450 132 / 4e-40 SAUR-like auxin-responsive protein family (.1) Potri.009G141150 [exp] 181 / 2e-59 AT1G29450 131 / 5e-40 SAUR-like auxin-responsive protein family (.1) Potri.009G141201 [exp] 181 / 2e-59 AT5G27780 132 / 3e-40 SAUR-like auxin-responsive protein family (.1) Potri.017G043500 [exp] 177 / 7e-58 AT5G27780 120 / 1e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G141100 [exp] 154 / 3e-49 AT1G29510 117 / 8e-35 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.009G140900 [exp] 142 / 4e-44 AT1G29510 139 / 3e-43 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.004G181500 [exp] 131 / 5e-40 AT1G29450 97 / 2e-26 SAUR-like auxin-responsive protein family (.1) Potri.009G141000 [exp] 131 / 6e-40 AT1G29500 122 / 2e-36 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023969 [exp] 100 / 2e-27 AT5G27780 96 / 1e-25 SAUR-like auxin-responsive protein family (.1) Lus10025114 [exp] 92 / 2e-24 AT1G29450 99 / 4e-27 SAUR-like auxin-responsive protein family (.1) Lus10023970 [exp] 92 / 4e-24 AT1G29450 97 / 2e-26 SAUR-like auxin-responsive protein family (.1) Lus10025115 [exp] 90 / 3e-23 AT1G29430 88 / 6e-23 SAUR-like auxin-responsive protein family (.1) Lus10034570 [exp] 74 / 6e-18 AT1G76190 122 / 2e-37 SAUR-like auxin-responsive protein family (.1) Lus10021825 [exp] 73 / 2e-17 AT1G76190 110 / 1e-32 SAUR-like auxin-responsive protein family (.1) Lus10003337 [exp] 72 / 3e-15 AT5G22800 855 / 0.0 EMBRYO DEFECTIVE 86, EMBRYO DEFECTIVE 263, EMBRYO DEFECTIVE 1030, Alanyl-tRNA synthetase, class IIc (.1) Lus10007060 [exp] 67 / 1e-14 AT1G29430 71 / 2e-16 SAUR-like auxin-responsive protein family (.1) Lus10007068 [exp] 66 / 1e-14 AT1G29510 68 / 1e-15 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Lus10007066 [exp] 66 / 1e-14 AT1G29430 66 / 5e-15 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.017G043600.1 pacid=42814015 polypeptide=Potri.017G043600.1.p locus=Potri.017G043600 ID=Potri.017G043600.1.v4.1 annot-version=v4.1 ATGATTAGTGCCAAGAAGCTCATCAAATTGGCAAGGAAGTGGCAGAAGCTGGCTGCTATCAGGAGAAAAAGGATCACACTGCCGCAACCCATTGAGAGAA CTGATACAAGCAGTTGCAGCACGTCGTCAACAACTCAGAAAGGCCACTTTGTAGTTTACTCCACCGATCAGAAGCGGTTTTCGCTTCCTTTAGAATATCT TCACAATAATATTGTCAGAGAGCTACTCGAAATTGCAGAAGAAGAACTTGGATCACCTAGCGATGGGCCTCTAACATTTCCATGTGATTCAGATCTTATG AAATATGTAGTTTCTTTGATAGAAAACCATATTTCTGCAGATGTAGAGAAAGCACTGTTGATGTCCATAGCCAGGAGTCACTGCTCAATGTCTTTGGATC CCCATCATGAAGTTCCAAGTCACCAAATACCAATTTGCAGCTTCTGA
AA sequence Show only first row Show all	>Potri.017G043600.1 pacid=42814015 polypeptide=Potri.017G043600.1.p locus=Potri.017G043600 ID=Potri.017G043600.1.v4.1 annot-version=v4.1 MISAKKLIKLARKWQKLAAIRRKRITLPQPIERTDTSSCSTSSTTQKGHFVVYSTDQKRFSLPLEYLHNNIVRELLEIAEEELGSPSDGPLTFPCDSDLM KYVVSLIENHISADVEKALLMSIARSHCSMSLDPHHEVPSHQIPICSF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G29500			SAUR-like auxin-responsive pro...		Potri.017G043600 [exp]	0	1	SAUR56
AT5G27780			SAUR-like auxin-responsive pro...		Potri.017G043400 [exp]	3.46	0.8882
AT5G27780			SAUR-like auxin-responsive pro...		Potri.017G043500 [exp]	5.29	0.8997
AT5G67070		RALFL34	ralf-like 34 (.1)		Potri.007G044700 [exp]	18.81	0.8322
AT5G66590			CAP (Cysteine-rich secretory p...		Potri.007G033200 [exp]	33.85	0.6790
AT5G44680			DNA glycosylase superfamily pr...		Potri.008G081000 [exp]	39.11	0.7245
AT5G20820			SAUR-like auxin-responsive pro...		Potri.006G137000 [exp]	40.12	0.6891	SAUR6
AT3G06350		EMB3004, MEE32	MATERNAL EFFECT EMBRYO ARREST ...		Potri.014G135500 [exp]	46.98	0.7620
AT1G53700		PK3AT, WAG1	PROTEIN KINASE 3 ARABIDOPSIS T...		Potri.011G139800 [exp]	55.42	0.6784	Pt-PSPK3.2
AT4G34760			SAUR-like auxin-responsive pro...		Potri.004G164400 [exp]	77.92	0.7273	SAUR29
AT5G13460		IQD11	IQ-domain 11 (.1)		Potri.001G021000 [exp]	156.34	0.6606

Compare expression of checked genes

Potri.017G043600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.