Potri.017G043700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G14110 311 / 8e-110 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G043900 380 / 1e-136 AT2G14110 320 / 1e-112 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007071 312 / 7e-110 AT2G14110 308 / 1e-108 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1)
Lus10020444 272 / 4e-94 AT2G14110 271 / 1e-93 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0137 HAD PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Representative CDS sequence
>Potri.017G043700.1 pacid=42814517 polypeptide=Potri.017G043700.1.p locus=Potri.017G043700 ID=Potri.017G043700.1.v4.1 annot-version=v4.1
ATGGGAGACGAGACGGTGAAAAACGATGCTTTGCAAGTTATTGGAATGTTTCAAGTGCTGCCTAGATTGGTCGTCTTCGATCTAGATTACACTCTCTGGC
CTTTCTATTGCGAATGTCGATCCAAGCGTGAAATGCCATCCTTGTTTCCCCAAGCTAAAGGCATATTATATGCACTCAAGGAAAAGGGGATTGACATGGC
CATTGCTTCTAGATCACCAACCTCAGATATTGCAAAGACATTTATTGACAAACTAAGTCTCAAGCCAATGTTTGTAGCACAGGAAATATTTTCCAGTAGG
ACTCACAAGATAGATCATTTCCAGATGATTCATACGAGGACTGGGATACCCTTTAACTCCATGCTTTTTTTTGATGATGAGAATAGGAACATTCAATCGG
TTTCAAAAATGGGAGTAACTAGCATTCTGGTTGGTGATGGGGTCAATCTTGGAGCACTAAGACAGGGGCTCTCAGAATTTTCTCAAAATGCTAGTAAATC
TGAGAAGAACAAGCAGAGGTGGCAGAAATATTCACAAAATCCAAATTCATCTGAGAAGAAAGATGAAGATTGA
AA sequence
>Potri.017G043700.1 pacid=42814517 polypeptide=Potri.017G043700.1.p locus=Potri.017G043700 ID=Potri.017G043700.1.v4.1 annot-version=v4.1
MGDETVKNDALQVIGMFQVLPRLVVFDLDYTLWPFYCECRSKREMPSLFPQAKGILYALKEKGIDMAIASRSPTSDIAKTFIDKLSLKPMFVAQEIFSSR
THKIDHFQMIHTRTGIPFNSMLFFDDENRNIQSVSKMGVTSILVGDGVNLGALRQGLSEFSQNASKSEKNKQRWQKYSQNPNSSEKKDED

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G14110 Haloacid dehalogenase-like hyd... Potri.017G043700 0 1
Potri.013G057766 2.00 0.8268
AT2G28060 5'-AMP-activated protein kinas... Potri.009G008700 4.00 0.7824
AT1G50940 ETFALPHA electron transfer flavoprotein... Potri.011G135600 5.29 0.8115
AT1G52280 AtRABG3d RAB GTPase homolog G3D (.1) Potri.003G053400 6.00 0.8091
AT3G04830 Protein prenylyltransferase su... Potri.005G051300 6.70 0.8188
AT4G31130 Protein of unknown function (D... Potri.006G280900 9.69 0.7514
Potri.003G011000 12.00 0.7511
AT2G21600 ATRER1B endoplasmatic reticulum retrie... Potri.005G228900 12.64 0.7584 RER1.4
AT5G67500 VDAC2, ATVDAC2 ARABIDOPSIS THALIANA VOLTAGE D... Potri.005G146800 13.37 0.8362
AT1G07950 MED22B Surfeit locus protein 5 subuni... Potri.008G080700 13.96 0.7840

Potri.017G043700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.