Potri.017G044550 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.017G044550.1 pacid=42813210 polypeptide=Potri.017G044550.1.p locus=Potri.017G044550 ID=Potri.017G044550.1.v4.1 annot-version=v4.1
ATGGAACTGTTGTTGGTGTTTCTAGAATCAAAGCCCTTCTTCAAAGAGTCTGGTGGATGGCCTGAAAGGACAACTGCACCAAACTCCATGCTAGTTTTCA
ATGCTCAACTCTTCATTTTCCAGCCAATAGCACCGTTCAACAGCATCACAACTCAAATTCTTGAACCCTGCAATATCCATCTCCAGTTTTTGCAATCTGT
TATGTGTTTCTTGAGCTTCTTCTTCTTTGTCAGATTTTCTCGAGGGATGTTAAATTTCTATAGCATTTGCTTGTTGATCTTGTATCTTATATGGGATTTC
TAG
AA sequence
>Potri.017G044550.1 pacid=42813210 polypeptide=Potri.017G044550.1.p locus=Potri.017G044550 ID=Potri.017G044550.1.v4.1 annot-version=v4.1
MELLLVFLESKPFFKESGGWPERTTAPNSMLVFNAQLFIFQPIAPFNSITTQILEPCNIHLQFLQSVMCFLSFFFFVRFSRGMLNFYSICLLILYLIWDF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.017G044550 0 1
AT4G39120 HISN7, IMPL2 HISTIDINE BIOSYNTHESIS 7, myo-... Potri.009G120600 2.00 0.9133
AT3G04500 RNA-binding (RRM/RBD/RNP motif... Potri.019G018900 2.82 0.9195
AT2G03220 ATFUT1, ATFT1, ... MURUS 2, ARABIDOPSIS THALIANA ... Potri.001G033800 12.80 0.8842
AT5G45390 NCLPP3, NCLPP4,... NUCLEAR-ENCODED CLP PROTEASE P... Potri.001G130601 22.44 0.7995
AT3G22930 CML11 calmodulin-like 11 (.1) Potri.002G047300 27.05 0.8861 Pt-ACCAL.7
AT3G02860 C2H2ZnF zinc ion binding (.1.2) Potri.017G135500 32.24 0.8816
AT5G49970 PDX3, ATPPOX HOMOLOG OF YEAST PYRIDOXINE AU... Potri.002G102600 39.10 0.8632
AT1G71000 Chaperone DnaJ-domain superfam... Potri.010G113400 40.64 0.8752
AT5G43150 unknown protein Potri.002G119700 41.02 0.7914
AT5G41990 EIP1, ATWNK8, W... EMF1-Interacting Protein 1, wi... Potri.001G085500 41.78 0.7897 WNK8.2

Potri.017G044550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.