Potri.017G046301 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G059701 112 / 1e-34 ND /
Potri.015G055951 91 / 3e-26 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.017G046301.1 pacid=42814181 polypeptide=Potri.017G046301.1.p locus=Potri.017G046301 ID=Potri.017G046301.1.v4.1 annot-version=v4.1
ATGGCATCGTCTAAAGCATTGCTGGTTTTGGGGGTTTTCATGCTCTTAATGACCACATTTGTAGCAGGAGATGTGGTCAATACCATTAGAGACAAGCCAC
CATACATAAGTTACGAAGGTCTTGGATGTGACCCAAAGAAGAATCCCCGGTGCCGCCTTAACCCAGACCCAGCCCCTTCAGGAAGAGGTTGCAAAGCCGA
ACATCGATGCAGGGAAGGCTAG
AA sequence
>Potri.017G046301.1 pacid=42814181 polypeptide=Potri.017G046301.1.p locus=Potri.017G046301 ID=Potri.017G046301.1.v4.1 annot-version=v4.1
MASSKALLVLGVFMLLMTTFVAGDVVNTIRDKPPYISYEGLGCDPKKNPRCRLNPDPAPSGRGCKAEHRCREG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.017G046301 0 1
AT5G27660 Trypsin family protein with PD... Potri.018G001550 1.73 0.8946
AT2G32990 ATGH9B8 glycosyl hydrolase 9B8 (.1) Potri.001G356000 4.58 0.8026
AT1G64660 ATMGL methionine gamma-lyase (.1) Potri.003G146600 14.17 0.8518
AT5G39130 RmlC-like cupins superfamily p... Potri.004G180100 14.28 0.7750
AT2G20430 RIC6 ROP-interactive CRIB motif-con... Potri.002G035500 16.58 0.8437
AT2G16230 O-Glycosyl hydrolases family 1... Potri.014G184900 18.00 0.8362
AT5G61620 MYB myb-like transcription factor ... Potri.001G080300 19.00 0.8082
AT1G64065 Late embryogenesis abundant (L... Potri.001G098200 19.59 0.7107
AT5G16970 AT-AER alkenal reductase (.1) Potri.007G143250 24.08 0.8056
AT3G04280 ARR22 response regulator 22 (.1.2.3) Potri.003G172200 24.81 0.8208

Potri.017G046301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.