Potri.017G046800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G047200 45 / 1e-06 ND /
Potri.007G114100 44 / 2e-06 ND /
Potri.017G045800 42 / 1e-05 ND /
Potri.017G045600 42 / 1e-05 ND /
Potri.017G045900 42 / 2e-05 ND /
Potri.017G047000 42 / 3e-05 ND /
Potri.007G114200 41 / 3e-05 ND /
Potri.017G046700 40 / 5e-05 ND /
Potri.017G046400 39 / 0.0001 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.017G046800.2 pacid=42813627 polypeptide=Potri.017G046800.2.p locus=Potri.017G046800 ID=Potri.017G046800.2.v4.1 annot-version=v4.1
ATGGCAAGTCTCAACTGTTTCATCTTAGCTCTTTTCATTGCTGTGTCACTTTCACGCGGCGAGGCAGCTCGTCATCTTCTGCAATTGCCCCCTTTACCTT
CCGTGCCCAGCTTGCCTAAACCAACATTGCCACCATTGCCTTCTATACCATCTCTGCCACAGCCCACATTGCCAACTTTGCCCACCACCCAACAACCTTC
ACTGCCTAAACCCTCTCTGCCTCCACTTCCAAGCATGCCAACACTGCCTACTGTCGTCCCCAAGGCCACCTTGCCTCCACTTCCAAGCATGCCAACACTG
CCTACTGTCGTCCCCAAGCTCAGCTTGCCTCCACTTCCAAGCATGCCTTCAATTCCCAATATCCCTCTCCCAACAACAATTCCCTCTATTCCATTCCTCT
CCCCGCCACCAGCTGGAAATTAG
AA sequence
>Potri.017G046800.2 pacid=42813627 polypeptide=Potri.017G046800.2.p locus=Potri.017G046800 ID=Potri.017G046800.2.v4.1 annot-version=v4.1
MASLNCFILALFIAVSLSRGEAARHLLQLPPLPSVPSLPKPTLPPLPSIPSLPQPTLPTLPTTQQPSLPKPSLPPLPSMPTLPTVVPKATLPPLPSMPTL
PTVVPKLSLPPLPSMPSIPNIPLPTTIPSIPFLSPPPAGN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.017G046800 0 1
Potri.007G113900 1.41 0.9965
Potri.019G082600 1.73 0.9954
Potri.007G114200 2.00 0.9963
AT5G09520 PELPK2 Pro-Glu-Leu|Ile|Val-Pro-Lys 2,... Potri.007G114525 4.24 0.9889
Potri.019G082733 4.47 0.9895
AT1G26560 BGLU40 beta glucosidase 40 (.1) Potri.010G159900 5.74 0.9631 HIUHASE.2
AT1G73165 CLE1 CLAVATA3/ESR-RELATED 1 (.1) Potri.011G096800 6.00 0.9555
AT5G06800 GARP myb-like HTH transcriptional r... Potri.001G228500 6.00 0.9625
Potri.002G021200 6.70 0.9706
AT5G07475 Cupredoxin superfamily protein... Potri.003G150300 7.48 0.9742

Potri.017G046800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.