Potri.017G047932 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G50011 86 / 1e-24 CPuORF37 conserved peptide upstream open reading frame 37 (.1)
AT5G09461 84 / 5e-24 CPuORF43 conserved peptide upstream open reading frame 43 (.1)
AT5G64341 81 / 8e-23 CPuORF40 conserved peptide upstream open reading frame 40 (.1)
AT1G29951 39 / 7e-06 CPuORF35 conserved peptide upstream open reading frame 35 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G112900 103 / 1e-31 AT5G50011 87 / 5e-25 conserved peptide upstream open reading frame 37 (.1)
Potri.005G158000 100 / 3e-30 AT5G50011 88 / 2e-25 conserved peptide upstream open reading frame 37 (.1)
Potri.002G103400 100 / 3e-30 AT5G50011 88 / 2e-25 conserved peptide upstream open reading frame 37 (.1)
Potri.011G080100 43 / 9e-08 AT1G29951 53 / 1e-11 conserved peptide upstream open reading frame 35 (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.017G047932.1 pacid=42814400 polypeptide=Potri.017G047932.1.p locus=Potri.017G047932 ID=Potri.017G047932.1.v4.1 annot-version=v4.1
ATGGTGTGCCAAGCAGCAAGTCAAACAAGATTTCGGGCCCTGAAATACGAGAATGGAATTGCTGGAAAACCAACAATTATAGTTAGAGTTATTGCATGCT
ATCGACCATTACAGGATTGCCAGGCTGAATACTTCCGTCATTTGCTCAAACCTGTCACGTAG
AA sequence
>Potri.017G047932.1 pacid=42814400 polypeptide=Potri.017G047932.1.p locus=Potri.017G047932 ID=Potri.017G047932.1.v4.1 annot-version=v4.1
MVCQAASQTRFRALKYENGIAGKPTIIVRVIACYRPLQDCQAEYFRHLLKPVT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G50011 CPuORF37 conserved peptide upstream ope... Potri.017G047932 0 1
AT5G50011 CPuORF37 conserved peptide upstream ope... Potri.002G103400 6.00 0.6780
AT2G31280 bHLH bHLH155 ,CPuORF... conserved peptide upstream ope... Potri.005G222550 6.16 0.6913
AT2G27228 CPuORF6 conserved peptide upstream ope... Potri.009G017600 10.86 0.6819
AT5G50011 CPuORF37 conserved peptide upstream ope... Potri.007G112900 12.24 0.6186
AT1G43850 SEU SEUSS transcriptional co-regul... Potri.013G089900 16.97 0.6369
AT5G50011 CPuORF37 conserved peptide upstream ope... Potri.005G158000 23.32 0.6482
AT2G31280 bHLH bHLH155 ,CPuORF... conserved peptide upstream ope... Potri.002G040550 27.82 0.6420
Potri.005G187000 29.10 0.6523
Potri.010G080633 36.48 0.6372
AT2G27228 CPuORF6 conserved peptide upstream ope... Potri.001G216800 43.81 0.6381

Potri.017G047932 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.