Potri.017G050300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.017G050300.1 pacid=42814053 polypeptide=Potri.017G050300.1.p locus=Potri.017G050300 ID=Potri.017G050300.1.v4.1 annot-version=v4.1
ATGGCTGGAAACAAGAGCATTGTTTTCTTGATGCTAATCACATTCCTAGCGAGCTCCACAATTGCACAACCTCCAGCATCCTCCCCTGCAACCTCACCCT
CCAAATCACCACCAAAAGCCTCTTCCCCAGCACCAAGCACCGTGAAGCCACCGGCATCTGCACCTTCTCCTTTGACAACTCCACCACCCAGTGCAGATGC
ACCATCCCCCGTCACCACCACCTCTCCTCCTTCTCCTCCTCCAGAGACCGCTCCTTCATCTTCCCCAACTGGTGTCCCAACTTCTACTATCTCTGACACT
CCAGCTGCAGCTCCCGGCCCCAACAGCGGTGCCGTTTTGAACAGATTTGCTTTCGGTGGATCTGTCGCTGTCGGTGTTTTCGCTGCCGTTTTGGTGCTTT
AA
AA sequence
>Potri.017G050300.1 pacid=42814053 polypeptide=Potri.017G050300.1.p locus=Potri.017G050300 ID=Potri.017G050300.1.v4.1 annot-version=v4.1
MAGNKSIVFLMLITFLASSTIAQPPASSPATSPSKSPPKASSPAPSTVKPPASAPSPLTTPPPSADAPSPVTTTSPPSPPPETAPSSSPTGVPTSTISDT
PAAAPGPNSGAVLNRFAFGGSVAVGVFAAVLVL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G64310 ATAGP1, AGP1 arabinogalactan protein 1 (.1) Potri.017G050300 0 1
AT3G51160 GMD2, MUR_1, MU... MURUS 1, GDP-D-MANNOSE-4,6-DEH... Potri.005G116200 5.47 0.8659 GMD1.2
AT5G64310 ATAGP1, AGP1 arabinogalactan protein 1 (.1) Potri.001G310400 7.93 0.8355
AT1G62440 LRX2 leucine-rich repeat/extensin 2... Potri.006G081200 8.60 0.8825
AT3G16850 Pectin lyase-like superfamily ... Potri.010G005500 18.97 0.8481
AT3G53380 Concanavalin A-like lectin pro... Potri.016G087800 19.28 0.8309
AT5G15350 AtENODL17 early nodulin-like protein 17 ... Potri.004G121100 26.60 0.8617
AT1G76520 Auxin efflux carrier family pr... Potri.011G145600 28.98 0.8256
AT5G59840 Ras-related small GTP-binding ... Potri.001G236100 29.66 0.8547 Pt-RAB8.2
AT5G58420 Ribosomal protein S4 (RPS4A) f... Potri.006G103700 39.49 0.8512
Potri.001G367600 41.56 0.8398

Potri.017G050300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.