Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-MSG.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G70840 115 / 2e-33 MLP31 MLP-like protein 31 (.1) AT1G70830 112 / 6e-32 MLP28 MLP-like protein 28 (.1.2.3.4.5) AT5G28010 109 / 7e-31 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70890 108 / 1e-30 MLP43 MLP-like protein 43 (.1) AT1G70850 107 / 2e-29 MLP34 MLP-like protein 34 (.1.2.3) AT5G28000 102 / 5e-28 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70880 98 / 2e-26 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G35260 91 / 6e-24 MLP165 MLP-like protein 165 (.1) AT1G23130 91 / 7e-24 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G14930 86 / 6e-22 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G051200 [exp] 209 / 4e-71 AT1G70840 116 / 3e-34 MLP-like protein 31 (.1) Potri.010G111000 [exp] 155 / 3e-49 AT1G70830 175 / 8e-57 MLP-like protein 28 (.1.2.3.4.5) Potri.008G131100 [exp] 105 / 2e-29 AT1G70890 107 / 3e-30 MLP-like protein 43 (.1) Potri.008G131300 [exp] 95 / 3e-25 AT1G14930 100 / 1e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.008G131200 [exp] 94 / 7e-25 AT1G14930 122 / 4e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.010G096000 [exp] 85 / 2e-21 AT1G24020 188 / 3e-62 MLP-like protein 423 (.1.2) Potri.004G051500 [exp] 53 / 3e-09 AT5G28010 69 / 4e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012742 [exp] 133 / 3e-40 AT1G70830 158 / 6e-50 MLP-like protein 28 (.1.2.3.4.5) Lus10020498 [exp] 132 / 5e-40 AT1G70830 160 / 7e-51 MLP-like protein 28 (.1.2.3.4.5) Lus10012466 [exp] 129 / 1e-38 AT1G70830 161 / 3e-51 MLP-like protein 28 (.1.2.3.4.5) Lus10020497 [exp] 113 / 2e-32 AT1G70840 148 / 4e-46 MLP-like protein 31 (.1) Lus10008932 [exp] 103 / 9e-28 AT4G14060 127 / 1e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10028887 [exp] 89 / 5e-23 AT2G01520 129 / 1e-38 \(Zusammen-CA\)-enhanced 1, MLP-like protein 328 (.1) Lus10042489 [exp] 88 / 1e-22 AT1G14960 104 / 5e-29 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10033397 [exp] 87 / 2e-22 AT1G14950 121 / 1e-35 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10042490 [exp] 84 / 3e-21 AT1G14930 107 / 3e-30 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10008930 [exp] 82 / 3e-20 AT5G28010 126 / 2e-37 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [poplar] [flax] Bet_v_1_like PF00407 [poplar] [flax] Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence Show only first row Show all	>Potri.017G051100.1 pacid=42814411 polypeptide=Potri.017G051100.1.p locus=Potri.017G051100 ID=Potri.017G051100.1.v4.1 annot-version=v4.1 ATGTCTCTTAGTAGTAGGATGGAGGTTGCTGTAGAAACCAGCGTTCCTGCTGAAAAGTTTCATGATATTTTCAGTACCAGTACAATAACCCAATTATCCT CCATGAGTCCTGCTAAGGTCCAAGCTATTCATCTCCTTAAAGGTGAATGGGAGAAACCTGGCTGTACTATCAGTTGGAATTTTTATATCGATGGAGCCCC TACGGCCGCCAAGGTTATGGAAGACATAGATAACACAAAACTATCGACCACCTTCAATGTGATTGAAGGAGATTTAATGGGGGCTTATAAGAGTTTCAAA GCCATCGTTCAAGCTACTCCAAAAGGTCATGGCAGCGTGGTGCGTTGGACAATGATATATGAGAAGCTGAGTGAAAATATTCCAGCTCCAACAGCATTTG TGGACTTTGCAGTCGATTTAACCAAAGATATTAATGCTCACATGACCCAAGCACAGGCATGA
AA sequence Show only first row Show all	>Potri.017G051100.1 pacid=42814411 polypeptide=Potri.017G051100.1.p locus=Potri.017G051100 ID=Potri.017G051100.1.v4.1 annot-version=v4.1 MSLSSRMEVAVETSVPAEKFHDIFSTSTITQLSSMSPAKVQAIHLLKGEWEKPGCTISWNFYIDGAPTAAKVMEDIDNTKLSTTFNVIEGDLMGAYKSFK AIVQATPKGHGSVVRWTMIYEKLSENIPAPTAFVDFAVDLTKDINAHMTQAQA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G70840		MLP31	MLP-like protein 31 (.1)		Potri.017G051100 [exp]	0	1	Pt-MSG.2
AT1G05990		RHS1 ,RHS2	ROOT HAIR SPECIFIC 1, EF hand ...		Potri.008G079132 [exp]	1.00	0.9644
					Potri.008G114000 [exp]	2.82	0.9644
AT5G07050			nodulin MtN21 /EamA-like trans...		Potri.005G222601 [exp]	3.74	0.9357
AT1G70840		MLP31	MLP-like protein 31 (.1)		Potri.017G051200 [exp]	4.00	0.9323	Pt-MSG.1
					Potri.012G086200 [exp]	4.89	0.9469
AT3G07510			unknown protein		Potri.014G176300 [exp]	5.91	0.9399
					Potri.008G014501 [exp]	7.07	0.9009
					Potri.012G085800 [exp]	7.07	0.9321
					Potri.012G085901 [exp]	8.36	0.9264
AT1G22030			unknown protein		Potri.001G211900 [exp]	10.81	0.9295

Compare expression of checked genes

Potri.017G051100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.