Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G78270 87 / 7e-22 ATUGT85A4 UDP-glucosyl transferase 85A4 (.1) AT1G22340 87 / 9e-22 ATUGT85A7 UDP-glucosyl transferase 85A7 (.1) AT1G22380 86 / 2e-21 ATUGT85A3 UDP-glucosyl transferase 85A3 (.1) AT1G22370 86 / 2e-21 ATUGT85A5 UDP-glucosyl transferase 85A5 (.1.2) AT1G22360 82 / 3e-20 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 (.1.2) AT1G22400 82 / 3e-20 ATUGT85A1, UGT85A1 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) AT3G02100 59 / 7e-12 UDP-Glycosyltransferase superfamily protein (.1) AT3G46660 59 / 8e-12 UGT76E12 UDP-glucosyl transferase 76E12 (.1) AT5G38010 54 / 4e-10 UDP-Glycosyltransferase superfamily protein (.1) AT5G59580 52 / 2e-09 UGT76E1 UDP-glucosyl transferase 76E1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G052166 [exp] 115 / 4e-32 AT1G22360 607 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052300 [exp] 112 / 5e-31 AT1G22360 603 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.001G312600 [exp] 105 / 1e-28 AT1G22360 586 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.001G313000 [exp] 101 / 5e-27 AT1G22360 564 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.002G098400 [exp] 92 / 7e-24 AT1G22360 640 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.016G018001 [exp] 88 / 2e-22 AT1G22370 418 / 4e-143 UDP-glucosyl transferase 85A5 (.1.2) Potri.017G052400 [exp] 88 / 3e-22 AT1G22360 620 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.006G022800 [exp] 88 / 3e-22 AT1G22400 470 / 1e-163 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Potri.017G052000 [exp] 87 / 7e-22 AT1G22360 617 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024584 [exp] 87 / 6e-22 AT1G22400 570 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10024583 [exp] 87 / 1e-21 AT1G22380 598 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10032220 [exp] 84 / 9e-21 AT1G22380 601 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10001880 [exp] 81 / 1e-20 AT1G22400 153 / 1e-43 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10031388 [exp] 82 / 7e-20 AT1G22400 644 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10013925 [exp] 80 / 2e-19 AT1G22380 560 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10032218 [exp] 79 / 5e-19 AT1G22380 564 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10000993 [exp] 79 / 5e-19 AT1G22380 563 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10041055 [exp] 79 / 5e-19 AT1G22360 610 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Lus10013922 [exp] 78 / 2e-18 AT1G22400 533 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.017G051900.2 pacid=42813202 polypeptide=Potri.017G051900.2.p locus=Potri.017G051900 ID=Potri.017G051900.2.v4.1 annot-version=v4.1 ATGGTGTCCATAGAATTGGCAAATAAACCCCATGCCGTGTGTATCCCTTTTCCAGCCCAGGGTCACATAAACCCAATGCTAAAACTAGCAAAACTACTCC ACTTCAAAGGTTTTCACATAACCTTTGTTAATACAGAGTATAACCACAGACGCTTACTCAAGTCTAGAGGCAGCAGCTCTCTTGATGGCTTTCCAGACTT CCATTGA
AA sequence Show only first row Show all	>Potri.017G051900.2 pacid=42813202 polypeptide=Potri.017G051900.2.p locus=Potri.017G051900 ID=Potri.017G051900.2.v4.1 annot-version=v4.1 MVSIELANKPHAVCIPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHRRLLKSRGSSSLDGFPDFH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G78270		ATUGT85A4	UDP-glucosyl transferase 85A4 ...		Potri.017G051900 [exp]	0	1
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Potri.017G052166 [exp]	1.00	0.9571
AT3G63310		BIL4	BRZ-INSENSITIVE-LONG HYPOCOTYL...		Potri.008G157100 [exp]	1.41	0.9566
AT5G42750		BKI1	BRI1 kinase inhibitor 1 (.1)		Potri.014G031100 [exp]	8.48	0.9434
					Potri.014G158501 [exp]	8.94	0.9451
AT2G02070	C2H2ZnF	ATIDD5	indeterminate(ID)-domain 5 (.1...		Potri.010G099100 [exp]	12.36	0.9426
AT5G52010	C2H2ZnF		C2H2-like zinc finger protein ...		Potri.014G025100 [exp]	19.97	0.9437
AT5G07670			RNI-like superfamily protein (...		Potri.001G125800 [exp]	20.49	0.9400
AT5G20090			Uncharacterised protein family...		Potri.001G333902 [exp]	26.98	0.8967
AT4G18740			Rho termination factor (.1.2.3...		Potri.011G069300 [exp]	33.91	0.9311
AT2G31220	bHLH	bHLH010	basic helix-loop-helix (bHLH) ...		Potri.006G202100 [exp]	36.66	0.9318

Compare expression of checked genes

Potri.017G051900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.