RPL13.2 (Potri.017G054600) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol RPL13.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G48760 352 / 4e-125 Ribosomal protein L13 family protein (.1.2)
AT3G24830 350 / 2e-124 Ribosomal protein L13 family protein (.1)
AT3G07110 350 / 2e-124 Ribosomal protein L13 family protein (.1.2)
AT4G13170 350 / 2e-124 Ribosomal protein L13 family protein (.1)
AT1G78630 55 / 4e-09 EMB1473 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G314500 377 / 5e-135 AT5G48760 384 / 7e-138 Ribosomal protein L13 family protein (.1.2)
Potri.002G242600 349 / 4e-124 AT4G13170 357 / 4e-127 Ribosomal protein L13 family protein (.1)
Potri.001G384600 51 / 1e-07 AT1G78630 351 / 1e-123 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Potri.011G106100 50 / 3e-07 AT1G78630 342 / 3e-120 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016679 357 / 4e-127 AT5G48760 386 / 9e-139 Ribosomal protein L13 family protein (.1.2)
Lus10007137 355 / 2e-126 AT5G48760 384 / 6e-138 Ribosomal protein L13 family protein (.1.2)
Lus10043151 353 / 1e-125 AT5G48760 380 / 2e-136 Ribosomal protein L13 family protein (.1.2)
Lus10032599 353 / 1e-125 AT5G48760 380 / 2e-136 Ribosomal protein L13 family protein (.1.2)
Lus10011857 351 / 1e-124 AT5G48760 394 / 8e-142 Ribosomal protein L13 family protein (.1.2)
Lus10022793 347 / 2e-123 AT5G48760 390 / 2e-140 Ribosomal protein L13 family protein (.1.2)
Lus10005553 48 / 2e-06 AT1G78630 332 / 8e-116 embryo defective 1473, Ribosomal protein L13 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00572 Ribosomal_L13 Ribosomal protein L13
Representative CDS sequence
>Potri.017G054600.1 pacid=42813021 polypeptide=Potri.017G054600.1.p locus=Potri.017G054600 ID=Potri.017G054600.1.v4.1 annot-version=v4.1
ATGGTGTCCGGGTCAGGGATCTGTGTAAAAAGAGTTGTTGTTGATGCAAGGCATCATATGCTAGGCAGGCTTGCATCAATAATAGCTAAAGAACTACTAA
ATGGACAAAGAGTTGTTGTTGTTAGGTGTGAAGAGATTTGCATCTCTGGTGGGTTAGTGAGGCAGAAAATGAAGTACTTGAGGTTCTTGAGGAAACGCAT
GAACACTAAACCTTCTCATGGTCCTATTCACTTCAGGGCTCCTTCGAAGATTCTCTGGCGTACCATTAGAGGGATGATTCCTCACAAGACCAAGCGTGGA
GAGGCTGCTCTTGCACGTTTGAAGGTTTTTGAGGGTGTTCCTCCTCCATATGACAAGACAAAGAGGATGGTTATCCCTGATGCTCTCAAGGTTTTGAGGC
TTCAGCCTGGACACAAGTATTGCTTGTTAGGTCAGCTTTCATCTGAGGTTGGATGGAACCACTATGATACCATCAAGGAGCTGGAGACGAAGAGAAAGGA
AAGAGCTCAATTGGTCTATGAGAGAAAGAAGCAGTTGGCTAAACTGAGGCTCAAGGCTGAGAAGACCGCAGAGGAGAAGCTAGGTCCCCAGCAAGAAATT
ATTGCTCCGCTCAAATATTGA
AA sequence
>Potri.017G054600.1 pacid=42813021 polypeptide=Potri.017G054600.1.p locus=Potri.017G054600 ID=Potri.017G054600.1.v4.1 annot-version=v4.1
MVSGSGICVKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICISGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG
EAALARLKVFEGVPPPYDKTKRMVIPDALKVLRLQPGHKYCLLGQLSSEVGWNHYDTIKELETKRKERAQLVYERKKQLAKLRLKAEKTAEEKLGPQQEI
IAPLKY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G48760 Ribosomal protein L13 family p... Potri.017G054600 0 1 RPL13.2
AT1G73230 Nascent polypeptide-associated... Potri.017G141100 2.00 0.9532
AT3G52590 HAP4, ERD16, UB... HAPLESS 4, EARLY-RESPONSIVE TO... Potri.012G024300 2.00 0.9616 Pt-UBQ1.2
AT5G27700 Ribosomal protein S21e (.1) Potri.005G026000 2.44 0.9634
AT2G42740 RPL16A ribosomal protein large subuni... Potri.011G069200 6.00 0.9561 L16.2
AT3G02560 Ribosomal protein S7e family p... Potri.006G087900 6.24 0.9344
AT2G07340 PFD1 PREFOLDIN 1 (.1.2) Potri.006G079700 7.87 0.9238
AT2G18110 Translation elongation factor... Potri.001G224700 8.36 0.9201
AT5G61170 Ribosomal protein S19e family ... Potri.004G118800 8.48 0.9440 RPS19.1
AT1G70600 Ribosomal protein L18e/L15 sup... Potri.006G202300 8.48 0.9513 Pt-RPL27.4
AT4G15000 Ribosomal L27e protein family ... Potri.016G019000 10.19 0.9444 RPL27.1

Potri.017G054600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.