Potri.017G055050 [POPLAR]

| External link |
|
|||||
|---|---|---|---|---|---|---|
| Symbol | ||||||
|
Arabidopsis homologues
|
No hit found | |||||
|
Paralogs
|
|
|||||
|
Flax homologues |
No hit found |
|||||
| PFAM info | ||||||
|
Representative CDS sequence |
>Potri.017G055050.1 pacid=42813682 polypeptide=Potri.017G055050.1.p locus=Potri.017G055050 ID=Potri.017G055050.1.v4.1 annot-version=v4.1
ATGTCTGGTGTCAGGCTCAAGAACAGTTTTAAAAAAATAATGAAGAATAAGGGAGGTATGAACGCTGATGATGCTGATAAGATGGCTGGATTTCAAGATT
TGGGTTATATTGGACATGGCTTCACCAAGAACAGTCGGCAGGATGAAGATGGCAACGTCTAG
|
|||||
|
AA sequence
|
>Potri.017G055050.1 pacid=42813682 polypeptide=Potri.017G055050.1.p locus=Potri.017G055050 ID=Potri.017G055050.1.v4.1 annot-version=v4.1
MSGVRLKNSFKKIMKNKGGMNADDADKMAGFQDLGYIGHGFTKNSRQDEDGNV
|
DESeq2's median of ratios [POPLAR]
Coexpressed genes
Potri.017G055050 coexpression network
*The number of genes in the network is adjusted within 50 genes.*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.