Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G13600 151 / 6e-46 Carbohydrate-binding X8 domain superfamily protein (.1) AT1G18650 110 / 2e-30 PDCB3 plasmodesmata callose-binding protein 3 (.1) AT5G61130 103 / 9e-28 PDCB1 plasmodesmata callose-binding protein 1 (.1) AT2G30933 102 / 5e-27 Carbohydrate-binding X8 domain superfamily protein (.1.2) AT4G09462 99 / 1e-26 Carbohydrate-binding X8 domain superfamily protein (.1) AT4G34480 105 / 2e-26 O-Glycosyl hydrolases family 17 protein (.1) AT1G11820 103 / 6e-26 O-Glycosyl hydrolases family 17 protein (.1.2) AT2G16230 103 / 6e-26 O-Glycosyl hydrolases family 17 protein (.1) AT2G05790 102 / 1e-25 O-Glycosyl hydrolases family 17 protein (.1) AT4G09465 96 / 1e-25 Carbohydrate-binding X8 domain superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G315700 [exp] 205 / 3e-67 AT4G13600 155 / 2e-47 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.012G065750 [exp] 112 / 7e-31 AT1G18650 142 / 1e-42 plasmodesmata callose-binding protein 3 (.1) Potri.015G057800 [exp] 108 / 1e-29 AT1G18650 151 / 3e-46 plasmodesmata callose-binding protein 3 (.1) Potri.013G003500 [exp] 110 / 2e-28 AT1G09460 144 / 3e-38 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.005G003500 [exp] 110 / 2e-28 AT2G30933 142 / 1e-38 Carbohydrate-binding X8 domain superfamily protein (.1.2) Potri.008G055900 [exp] 104 / 2e-26 AT3G55430 494 / 8e-174 O-Glycosyl hydrolases family 17 protein (.1) Potri.010G173500 [exp] 103 / 2e-26 AT1G79480 162 / 3e-46 Carbohydrate-binding X8 domain superfamily protein (.1.2) Potri.008G082900 [exp] 103 / 2e-26 AT1G79480 159 / 3e-45 Carbohydrate-binding X8 domain superfamily protein (.1.2) Potri.006G008200 [exp] 101 / 2e-26 AT1G79480 142 / 8e-40 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032601 [exp] 168 / 3e-53 AT4G13600 167 / 2e-52 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10021619 [exp] 113 / 6e-31 AT1G18650 151 / 1e-45 plasmodesmata callose-binding protein 3 (.1) Lus10034690 [exp] 112 / 2e-30 AT1G18650 157 / 8e-48 plasmodesmata callose-binding protein 3 (.1) Lus10040522 [exp] 111 / 3e-30 AT1G18650 158 / 7e-49 plasmodesmata callose-binding protein 3 (.1) Lus10021157 [exp] 110 / 3e-30 AT1G18650 157 / 7e-49 plasmodesmata callose-binding protein 3 (.1) Lus10037071 [exp] 109 / 8e-30 AT1G18650 138 / 3e-41 plasmodesmata callose-binding protein 3 (.1) Lus10036914 [exp] 105 / 3e-28 AT1G18650 139 / 2e-41 plasmodesmata callose-binding protein 3 (.1) Lus10040808 [exp] 106 / 1e-26 AT5G24318 484 / 2e-168 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10016539 [exp] 104 / 3e-26 AT5G24318 484 / 1e-168 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10004962 [exp] 104 / 3e-26 AT5G24318 462 / 8e-161 O-Glycosyl hydrolases family 17 protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07983 [poplar] [flax] X8 X8 domain
Representative CDS sequence Show only first row Show all	>Potri.017G055700.1 pacid=42812918 polypeptide=Potri.017G055700.1.p locus=Potri.017G055700 ID=Potri.017G055700.1.v4.1 annot-version=v4.1 ATGGAAAATCTGCTCCCTAACAAACTATTCTTCATCTTCTTCGCCATTCACGTTCTTGGGGGTGCAATGTTCTTGGCAGTGGTGGTGGAAGGGAACTGGT GTGTGGCAAGAAGTGATGCAAGTAACCAAGCCTTGCAAACTGCACTCGACTATGCATGCGGTTCTGGTGCCGACTGTACTCCATTACAGTCTAATGGACT ATGCTTCTTGCCTAACTCAATCCAGGCTCATGCTTCTTATGCATTCAATAGCTACTTTCAAAGGAAAGGAATGGCTCCTGGCTCCTGTGACTTTTCTGGC ACTGCTACTGTTGCAAAAACTGATCCCAGTTACGGATCTTGTGTGTATCCATCCTCTCTAAGCACTGCCGGAGGGGCTGGCACCACTTCAAGCACCACAC CAAATACTAACCCCAACATACAATCACCGACATTTGGCGATGGTTCCACCGGACTGAACCCTGGACTAAACCCCGGAACGCCTCCACTGCTGGACAATTC TGAATCTTCTCTAGGGTTTGTGGCCACAAGAACCTTACTGCCTCTGTGCCTCTTGCTTGTTCTCTCATTTACGTTTCGCCCCATGTAG
AA sequence Show only first row Show all	>Potri.017G055700.1 pacid=42812918 polypeptide=Potri.017G055700.1.p locus=Potri.017G055700 ID=Potri.017G055700.1.v4.1 annot-version=v4.1 MENLLPNKLFFIFFAIHVLGGAMFLAVVVEGNWCVARSDASNQALQTALDYACGSGADCTPLQSNGLCFLPNSIQAHASYAFNSYFQRKGMAPGSCDFSG TATVAKTDPSYGSCVYPSSLSTAGGAGTTSSTTPNTNPNIQSPTFGDGSTGLNPGLNPGTPPLLDNSESSLGFVATRTLLPLCLLLVLSFTFRPM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G13600			Carbohydrate-binding X8 domain...		Potri.017G055700 [exp]	0	1
AT5G67070		RALFL34	ralf-like 34 (.1)		Potri.005G139100 [exp]	1.41	0.8905
AT1G10380			Putative membrane lipoprotein ...		Potri.010G158500 [exp]	2.00	0.8846
AT5G39950		ATTRXH2, ATTRX2...	Arabidopsis thioredoxin h2, th...		Potri.017G076700 [exp]	3.46	0.8562	PtrTrxh2
AT3G58690			Protein kinase superfamily pro...		Potri.014G143100 [exp]	3.87	0.8845
AT5G46700		TRN2, TET1	TORNADO 2, TETRASPANIN 1, Tetr...		Potri.001G141400 [exp]	5.65	0.8473
AT1G18650		PDCB3	plasmodesmata callose-binding ...		Potri.015G057800 [exp]	8.36	0.8625
AT5G01120			Protein of unknown function (D...		Potri.001G247200 [exp]	8.66	0.8115
AT1G07790		HTB1	Histone superfamily protein (....		Potri.010G231300 [exp]	8.71	0.8772
AT1G46264	HSF	SCZ, AT-HSFB4	SCHIZORIZA, heat shock transcr...		Potri.014G027100 [exp]	8.77	0.8518	Pt-HSFB4.2
AT3G48610		NPC6	non-specific phospholipase C6 ...		Potri.012G099300 [exp]	9.94	0.8038

Compare expression of checked genes

Potri.017G055700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.