Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G06240 138 / 6e-37 F-box family protein (.1) AT4G12560 110 / 9e-27 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) AT3G23880 96 / 7e-22 F-box and associated interaction domains-containing protein (.1) AT3G16210 92 / 8e-21 F-box family protein (.1) AT3G21120 85 / 3e-18 F-box and associated interaction domains-containing protein (.1) AT3G08750 83 / 2e-17 F-box and associated interaction domains-containing protein (.1) AT1G47790 82 / 3e-17 F-box and associated interaction domains-containing protein (.1) AT3G16590 79 / 5e-16 F-box and associated interaction domains-containing protein (.1) AT1G33530 79 / 6e-16 F-box family protein (.1) AT4G22390 79 / 6e-16 F-box associated ubiquitination effector family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G318300 [exp] 463 / 3e-164 AT3G06240 140 / 7e-38 F-box family protein (.1) Potri.001G318400 [exp] 329 / 3e-111 AT3G06240 142 / 3e-38 F-box family protein (.1) Potri.017G058900 [exp] 222 / 2e-69 AT3G06240 132 / 2e-34 F-box family protein (.1) Potri.006G013000 [exp] 152 / 5e-42 AT4G12560 250 / 5e-79 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.008G199800 [exp] 152 / 6e-42 AT3G23880 182 / 3e-53 F-box and associated interaction domains-containing protein (.1) Potri.006G013200 [exp] 122 / 2e-31 AT4G12560 289 / 4e-94 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.001G035500 [exp] 119 / 3e-30 AT4G12560 271 / 3e-87 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.011G037312 [exp] 114 / 2e-28 AT3G07870 134 / 3e-35 F-box and associated interaction domains-containing protein (.1) Potri.011G037200 [exp] 113 / 4e-28 AT3G07870 134 / 6e-35 F-box and associated interaction domains-containing protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038603 [exp] 120 / 3e-30 AT3G06240 110 / 2e-26 F-box family protein (.1) Lus10008871 [exp] 117 / 2e-29 AT4G12560 135 / 1e-35 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10023238 [exp] 113 / 4e-28 AT3G23880 126 / 6e-33 F-box and associated interaction domains-containing protein (.1) Lus10037892 [exp] 108 / 2e-26 AT3G06240 107 / 7e-26 F-box family protein (.1) Lus10012358 [exp] 108 / 3e-26 AT3G07870 181 / 3e-52 F-box and associated interaction domains-containing protein (.1) Lus10038606 [exp] 107 / 8e-26 AT3G07870 112 / 1e-27 F-box and associated interaction domains-containing protein (.1) Lus10008870 [exp] 105 / 3e-25 AT3G23880 126 / 9e-33 F-box and associated interaction domains-containing protein (.1) Lus10023239 [exp] 103 / 1e-24 AT3G23880 130 / 3e-34 F-box and associated interaction domains-containing protein (.1) Lus10001105 [exp] 97 / 5e-22 AT3G06240 109 / 3e-26 F-box family protein (.1) Lus10018106 [exp] 96 / 1e-21 AT3G06240 95 / 3e-21 F-box family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [poplar] [flax] F-box PF00646 [poplar] [flax] F-box F-box domain CL0162 [poplar] [flax] FBA PF07734 [poplar] [flax] FBA_1 F-box associated
Representative CDS sequence Show only first row Show all	>Potri.017G058000.1 pacid=42814179 polypeptide=Potri.017G058000.1.p locus=Potri.017G058000 ID=Potri.017G058000.1.v4.1 annot-version=v4.1 ATGTCAAAACTCCCCCAAGAAATCATTGTTGATATTCTCACCTATTTACCAGCCAAGTCGCTCATAAAATTCAAGTGTGTGTGCAGATCATGGCGGTCAT TAATCTCCGATCCTCAATTTGCCAAGTTGCATCTCAAAAGGGCACATGAAGACGAGAACATTAACCGTCAAAGGCTCCTCATTGCTGCTGATCCTCTTTA TTCTGTAGACTTTGAAGCAGCTAGTGATGGTGATAATGGCAATACATTAGTGAAGCTTTCTTATCCTAACGCAGAGAGTCATAACGACTCCTTCGCTGTT GGATTATTTCTGGGATCTTGTGATGGCATAGTATGTATACTTAATGAAGTTGATAGTGTGGTCTTATGGAATCCATCAACTAGAGAGTCCAAGAAATTGT CAGGACCAACTTCTTCTCTGCACAAAGATTTCTCGACTGGACTTGGTTATGATTCCTCTACTGATGATTACAAAATGGTAATTGCCTCTTCAGCTACTGC CAGTACTCGCTCTGATCAAATTATGGTTGAAGTCTTCACATTGAAAACCAATACATGGAGAACAGTTCAAGGCAGCCTTCCTGGTATCACCTTGGGAAGT AATTACTATGGAGAATTTTGGAATGGAGCTCTGCTTTGGCTAGGGAAGCGTGATGCTGCTCATCATTTGGATGTTATTGTTCCATTTGATATAGAAAAAG AGAAATTCATGGAGGCTGAGCCACTTCCAAATCATTTTTATACAGCAGTTTTGAGCATCTCAGGAAATTGCTTATGTGTTTTTGGCGAACTACAACCATC TGGAAGCTATTTTGAAGCATGGTTAGCAAGTGAATACGGTGTCAAGACAACATGGAGAAGATTGTTTGTCGTCCCAGCTGACAAACTATGTCTAGATTGT TATTCATCAGGGATGTGGTTGACAAAGAAAGGGGAAGTTCTGTTAGACAATCATGGATGTCCAGGGATATTGACACTGTACAACCCAGTAGAAGATGCAA AAAAGTTATTGAAGGTAGAGAATGATGGTGATCCATTTTATGAATCGGCAATATATACAGAAAGTCTGGTTTCACTATGCTAA
AA sequence Show only first row Show all	>Potri.017G058000.1 pacid=42814179 polypeptide=Potri.017G058000.1.p locus=Potri.017G058000 ID=Potri.017G058000.1.v4.1 annot-version=v4.1 MSKLPQEIIVDILTYLPAKSLIKFKCVCRSWRSLISDPQFAKLHLKRAHEDENINRQRLLIAADPLYSVDFEAASDGDNGNTLVKLSYPNAESHNDSFAV GLFLGSCDGIVCILNEVDSVVLWNPSTRESKKLSGPTSSLHKDFSTGLGYDSSTDDYKMVIASSATASTRSDQIMVEVFTLKTNTWRTVQGSLPGITLGS NYYGEFWNGALLWLGKRDAAHHLDVIVPFDIEKEKFMEAEPLPNHFYTAVLSISGNCLCVFGELQPSGSYFEAWLASEYGVKTTWRRLFVVPADKLCLDC YSSGMWLTKKGEVLLDNHGCPGILTLYNPVEDAKKLLKVENDGDPFYESAIYTESLVSLC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G06240			F-box family protein (.1)		Potri.017G058000 [exp]	0	1
AT2G36690			2-oxoglutarate (2OG) and Fe(II...		Potri.010G231500 [exp]	2.64	0.8948
AT1G76490		HMGR1, HMG1, At...	3-HYDROXY-3-METHYLGLUTARYL COA...		Potri.009G169900 [exp]	10.86	0.8537
AT1G66200		ATGSR2, GLN1;2	glutamine synthetase 1;2, glut...		Potri.005G093200 [exp]	15.65	0.8102	NCPGS.4
AT4G35160			O-methyltransferase family pro...		Potri.004G050400 [exp]	17.32	0.8273	FOMT2,Pt-OOMT2.13
AT2G23770			protein kinase family protein ...		Potri.010G078700 [exp]	17.74	0.8218
AT1G74190		AtRLP15	receptor like protein 15 (.1)		Potri.005G013100 [exp]	23.06	0.8222
AT1G27100			Actin cross-linking protein (....		Potri.004G130200 [exp]	28.77	0.8053
AT4G37370		CYP81D8	"cytochrome P450, family 81, s...		Potri.005G143900 [exp]	39.11	0.8048	IFS1.45,CYP81S8
AT5G16970		AT-AER	alkenal reductase (.1)		Potri.017G002950 [exp]	40.24	0.7082
AT3G22060			Receptor-like protein kinase-r...		Potri.017G039966 [exp]	40.89	0.6592

Compare expression of checked genes

Potri.017G058000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.